PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01809.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 222aa    MW: 24356.4 Da    PI: 8.3255
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01809.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM35.62.7e-111661248
                           NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                  ++G++F+Ptd+e+vv+yL+ ++ +++l+   +i++ di++++P+dL 
  Zmw_sc01809.1.g00020.1.sm.mk 16 AQGYKFNPTDQEIVVRYLRCRAVNRQLPS-AIIADRDILDHHPSDLV 61
                                  68************************999.88*************94 PP

2NAM33.11.6e-106492100128
                           NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                                   +g+k+tLvfy+g+ p+ge+tdWvm ey+l
  Zmw_sc01809.1.g00020.1.sm.mk  64 TGIKRTLVFYHGKPPSGERTDWVMREYSL 92 
                                   79*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100514.6451156IPR003441NAC domain
SuperFamilySSF1019411.83E-2312102IPR003441NAC domain
PfamPF023652.7E-91792IPR003441NAC domain
SuperFamilySSF1019411.83E-23144156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MAASIPLASG ATIPLAQGYK FNPTDQEIVV RYLRCRAVNR QLPSAIIADR DILDHHPSDL  60
VPETGIKRTL VFYHGKPPSG ERTDWVMREY SLAGRGLSPY RVMMPCTNNN SGQLNGIVKE  120
HEDPSVTFSA TAPSIENANI MLNPDSSWVV CRIHKKRARK SPLIIRANNN AGAEKIPFYD  180
FHGQGNHYEG TASSCVPPVE KENSEVQNKG GSSENASTKD GI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44822369