PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01797.1.g00060.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 210aa    MW: 22977.2 Da    PI: 8.7538
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++k++g +l +  v++evd+y+++Pw+Lp+k+ ++ekewyfFs+rd+ky++g+r+nra+ +g   9 LPPGFRFHPTDEELVNYYLCRKCAGLPLAA-PVMAEVDLYRFDPWQLPEKAMGGEKEWYFFSPRDRKYPNGSRPNRAAGTG 88 
                                   79*************************999.89***************8888999************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg dk+v s   + v +kk Lvfy g+ pkg+kt+W+mheyrl  89 YWKATGADKPVGS--PRPVAIKKALVFYAGKPPKGVKTNWIMHEYRL 133
                                   ***********99..779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-576136IPR003441NAC domain
PROSITE profilePS5100553.0499149IPR003441NAC domain
PfamPF023658.3E-2710133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-6821338140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses. {ECO:0000269|PubMed:20632034}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by dehydration, salt stress, cold stress, abscisic acid (ABA) and methyl jasmonate. {ECO:0000269|PubMed:20632034}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697580.11e-101PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 71-like
SwissprotQ53NF74e-95NAC71_ORYSJ; NAC domain-containing protein 71
TrEMBLA0A1X7YEW91e-99A0A1X7YEW9_MAIZE; Uncharacterized protein
TrEMBLC0PNU14e-99C0PNU1_MAIZE; Uncharacterized protein
STRINGGRMZM2G123667_P025e-98(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
  2. Sperotto RA, et al.
    Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains.
    J. Plant Physiol., 2010. 167(17): p. 1500-6
  3. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
  4. Kan CC,Chung TY,Juo YA,Hsieh MH
    Glutamine rapidly induces the expression of key transcription factor genes involved in nitrogen and stress responses in rice roots.
    BMC Genomics, 2015. 16(1): p. 731