PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01788.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ERF
Protein Properties Length: 458aa    MW: 47607.6 Da    PI: 7.1814
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01788.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP237.55.9e-123283153
                           AP2  1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkl 53
                                  ++y GVr  ++ +++ A Irdps ++  kr +lg+++taeeAa a++aa + l
  Zmw_sc01788.1.g00120.1.sm.mk 32 KKYIGVR-SRYGNKFGADIRDPSRGNAAKRLWLGTYDTAEEAACAHDAAVRTL 83
                                  59****9.7789*********9764346********************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000182.82E-173294No hitNo description
PROSITE profilePS5103215.3963392IPR001471AP2/ERF domain
SuperFamilySSF541711.44E-123393IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.103.9E-193393IPR001471AP2/ERF domain
PfamPF008471.4E-43379IPR001471AP2/ERF domain
SMARTSM003805.7E-153398IPR001471AP2/ERF domain
PRINTSPR003678.4E-53445IPR001471AP2/ERF domain
PRINTSPR003678.4E-55975IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MEGGLTGYAK AAASKIKADR EAQGREPSSP GKKYIGVRSR YGNKFGADIR DPSRGNAAKR  60
LWLGTYDTAE EAACAHDAAV RTLSPNTRTN FPDLGEKEER DAVVHAHLAK TRRKLARVAD  120
GKMEAAEAAL AGARDIVSTL PAPPPSPAPA GDVVDLTDSP TGSPGEDDAV AALDMLQGQG  180
QAPEPVASSV SPAPPPPSAP HFVPSPVSEA FNSNDNLTQA ASGGASVAQN TPVLALPALV  240
NSFFPSPHAM ALPPPPGFPF APIFDPPPLA SHFPPRWIAR PPGFHLAPAP TAPATEAIVT  300
STPSPSTMAP VGGASAPNFA SFWGPVAAPP AFNPPHTTAP PPGFHPAPAS ATTALPITPE  360
TWEFLYQYHA ALSPVQAQHH LKILRELLPL SFFGPAIMNT DASSSAAPAI SESQPEVEAF  420
RKLYRLLEKQ AAGAPVDAPV YDPGKQDGRR KKKRSGGA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1448453RRKKKR
2448454RRKKKRS
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1971958