PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01765.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 459aa    MW: 50486.8 Da    PI: 8.8057
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01765.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.12.9e-5231301128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat+
  Zmw_sc01765.1.g00030.1.am.mk   3 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATT 82 
                                   79****************************.99**************95334445667*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWkatgkd+++ + +g + g++ktLvfy+grap ge+tdWvmheyrl
  Zmw_sc01765.1.g00030.1.am.mk  83 TGYWKATGKDRRIAC-DGGVYGVRKTLVFYRGRAPGGERTDWVMHEYRL 130
                                   ***************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-582166IPR003441NAC domain
PROSITE profilePS5100555.9123167IPR003441NAC domain
PfamPF023657.8E-294130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MTLPPGFRFH PTDDELVGYY LKRKVDNLKI ELEVIPVIDL YKSEPWELPE KSFLPKRDLE  60
WFFFCPRDRK YPNGSRTNRA TTTGYWKATG KDRRIACDGG VYGVRKTLVF YRGRAPGGER  120
TDWVMHEYRL CQDLVHGASN FIVRPSSTTG PFITFQGGYA LCRVIKRHEA GLLQGEPPAR  180
AKGASTAGGA RGGQMTKVPS NSSLVSSDQL STFASTNSGS PPLDMRRGMC TVVESCNNFQ  240
NSLAYGGDAC DMAGTCATNG LPPPLFAPSD TSSQMCAPPH DLFFIGDDLP AAESRLSAGR  300
EYFFGDETGS VSERELKWDD LPIPTATANT FPTTTATDML CRQASDGIDD LAAFFFSDEN  360
RLAVDDGEKG RTQRGGRNPE GAPLLATDRK NNERNRTVHS WNLTARGEER VGAVAVSSRR  420
RPRFRARRRC GSVASSVRSH FCSPGPGIVV CPRKVKVAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-49113013140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1418428RRRPRFRARRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792378.11e-154NAC domain-containing protein 71-like
TrEMBLA0A2T7C9T31e-153A0A2T7C9T3_9POAL; Uncharacterized protein
STRINGPavir.Ia03491.1.p1e-155(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854