PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01755.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 452aa    MW: 48565.6 Da    PI: 9.1673
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01755.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26063.84.2e-20196242147
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 
                                   +CaaCk+lrr+Ca +Cv+apyfp ++p+kfanvh++FGasnv+kll+
  Zmw_sc01755.1.g00050.1.am.mk 196 PCAACKLLRRRCAVGCVFAPYFPPAEPHKFANVHRIFGASNVSKLLQ 242
                                   7********************************************98 PP

2DUF26054.63.1e-1732737948100
                        DUF260  48 alpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                   ++p ++r da+sslvyeA+ar+rdPvyG+v+ i++lqqq+e+l+a+lal+++e
  Zmw_sc01755.1.g00050.1.am.mk 327 EIPVQHRGDAVSSLVYEANARVRDPVYGCVAAISSLQQQVETLQAQLALAQAE 379
                                   578999*******************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.716195312IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-19196242IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-15326377IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MRGMESEIKK EAGRSVDGRK APGWGGMHDG TAAARSLSVW CPYQTSLSQL PMSSPTLCEL  60
FPSLSVVCGH VLCTFRRLLC SPPVSLYLCM PAGLRWDRKG ARLQLLLLQK DPSRPTCPVL  120
ACNYQHSQPP NLATTIHIGG QQSRLHSTPS DHRCGAWTLR FRGHAVLSFL AMKDEAAVGG  180
GRAAGAGGGG ATAAAPCAAC KLLRRRCAVG CVFAPYFPPA EPHKFANVHR IFGASNVSKL  240
LQVRAANSLL AGCFGYRLAC SDRDRASVFS SNLHADGAGT NSPYVAHRLF PAGYVRKKLQ  300
VHHRAAAPAS TDTPWCFSAN LACSTIEIPV QHRGDAVSSL VYEANARVRD PVYGCVAAIS  360
SLQQQVETLQ AQLALAQAEM VRLNMNNAYM AHRLKKARSI GGGGSSTNTG SPSSMSSPKM  420
EQPETHCKAT PELLDMVVDQ PYSMDDSQLW SY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-201933828113LOB family transfactor Ramosa2.1
5ly0_B1e-201933828113LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3525234