PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01742.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 321aa    MW: 34693.3 Da    PI: 9.441
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01742.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.81.3e-50131411128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhP+d+elv++yL++kv+g+  ++ ++  + +vd+++vePwdLp++++ + +ewyfFs +d+kyatg+r+nrat 
  Zmw_sc01742.1.g00030.1.am.mk  13 LPPGFRFHPRDDELVCDYLAPKVAGRVgFSGSRPpMVDVDLNRVEPWDLPAAASVGPREWYFFSLKDRKYATGQRTNRATV 93 
                                   79***********************9986665666***************88888999*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   sgyWkatgkd++v + +g+lvg++ktLvfy+grapkg+kt+Wv heyr+
  Zmw_sc01742.1.g00030.1.am.mk  94 SGYWKATGKDRPVAR-RGALVGMRKTLVFYQGRAPKGRKTEWVTHEYRM 141
                                   **************9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-564165IPR003441NAC domain
PROSITE profilePS5100555.24613165IPR003441NAC domain
PfamPF023651.2E-2514141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSASFLSMVE AGLPPGFRFH PRDDELVCDY LAPKVAGRVG FSGSRPPMVD VDLNRVEPWD  60
LPAAASVGPR EWYFFSLKDR KYATGQRTNR ATVSGYWKAT GKDRPVARRG ALVGMRKTLV  120
FYQGRAPKGR KTEWVTHEYR MEGHEQSPKL AAKEEDWVLC RVICKKKSAG GGATTKPARG  180
FATNGYDTAT TTSPPPPALM DTTLAQLQAA MNTKGAGAGA IEQVPCFSSF NNIASNSVSA  240
ANAAQQCYLP VATSSNGMSY LDHGLTDLGS CFDPLNSDKK WLKAVLSQVG GAVMHSPPPD  300
VAAAASSTWM NHFYENYGGR I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-501016812171Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805880.11e-177NAC domain-containing protein 21/22-like
TrEMBLA0A2T7EJ771e-176A0A2T7EJ77_9POAL; Uncharacterized protein
STRINGSi022747m1e-158(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100223144