PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01721.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 208aa    MW: 21647.5 Da    PI: 9.0895
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01721.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP71.31.8e-224388247
                                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS
                           SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47
                                  Cq+++C +dl++ak+yh+rhkvCe+hska+vv+v+gl+qrfCqqCs
  Zmw_sc01721.1.g00090.1.am.mk 43 CQADRCGVDLADAKRYHKRHKVCETHSKAAVVIVAGLQQRFCQQCS 88
                                  *********************************************9 PP

2SBP48.91.8e-151051374577
                                   TTSSEEETTT--SS--S-STTTT-------S-- CS
                           SBP  45 qCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                      rfhelsefD+ krsCrrrLa+hnerrrk +
  Zmw_sc01721.1.g00090.1.am.mk 105 PLLRFHELSEFDDIKRSCRRRLAGHNERRRKGA 137
                                   5569**************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.5E-3236123IPR004333Transcription factor, SBP-box
PROSITE profilePS5114126.63240136IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3041139IPR004333Transcription factor, SBP-box
PfamPF031101.1E-174389IPR004333Transcription factor, SBP-box
PfamPF031101.0E-8108135IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MDEDAKPPTP GGASGSLAPT AVVPVSARRG PSANGGGGGG PSCQADRCGV DLADAKRYHK  60
RHKVCETHSK AAVVIVAGLQ QRFCQQCSSP LVITSPRLQS PYVRPLLRFH ELSEFDDIKR  120
SCRRRLAGHN ERRRKGAADP HGGGGGGGGT GGVGGGGCRH ADQGXXXGQP APGEPAADQM  180
NEPTLHHQAC SLSSVMHAAR HGRCCIRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-3234135284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356783.12e-41PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ6Z4612e-37SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A3S3N6M91e-42A0A3S3N6M9_9MAGN; Squamosa promoter binding-like protein 3c
STRINGMLOC_13032.13e-41(Hordeum vulgare)
STRINGTraes_2BS_186EA570A.13e-41(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248