PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01696.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 146aa    MW: 16885.3 Da    PI: 6.5207
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01696.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.75.8e-46201461126
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lp Gf FhP+dee++++yLk+k  ++++++ ++i+++di+++ePw+Lp+k+k +ekewyf++++d+ky++g r nrat++g
  Zmw_sc01696.1.g00030.1.sm.mk  20 LPLGFGFHPSDEEIITFYLKPKKLDSNFTA-DAIADADINNSEPWELPMKAKMGEKEWYFYCQKDHKYQKGVRINRATNDG 99 
                                   699************************999.99***************99999**************************** PP

                           NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmhey 126
                                   +Wka gkd+++       ++vg+kktLvfy gr+p gekt+W+mhey
  Zmw_sc01696.1.g00030.1.sm.mk 100 FWKAIGKDRDLSGIimMPAVVGMKKTLVFYIGRSPWGEKTEWIMHEY 146
                                   *********98765557888**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-4917146IPR003441NAC domain
PROSITE profilePS5100547.28820146IPR003441NAC domain
PfamPF023652.5E-2321146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MENHKYEGIR GTVDDAGLNL PLGFGFHPSD EEIITFYLKP KKLDSNFTAD AIADADINNS  60
EPWELPMKAK MGEKEWYFYC QKDHKYQKGV RINRATNDGF WKAIGKDRDL SGIIMMPAVV  120
GMKKTLVFYI GRSPWGEKTE WIMHEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-3881465140NO APICAL MERISTEM PROTEIN
1ut4_B3e-3881465140NO APICAL MERISTEM PROTEIN
1ut7_A3e-3881465140NO APICAL MERISTEM PROTEIN
1ut7_B3e-3881465140NO APICAL MERISTEM PROTEIN
3swm_A3e-3881468143NAC domain-containing protein 19
3swm_B3e-3881468143NAC domain-containing protein 19
3swm_C3e-3881468143NAC domain-containing protein 19
3swm_D3e-3881468143NAC domain-containing protein 19
3swp_A3e-3881468143NAC domain-containing protein 19
3swp_B3e-3881468143NAC domain-containing protein 19
3swp_C3e-3881468143NAC domain-containing protein 19
3swp_D3e-3881468143NAC domain-containing protein 19
4dul_A3e-3881465140NAC domain-containing protein 19
4dul_B3e-3881465140NAC domain-containing protein 19
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024983086.16e-57NAC domain-containing protein 92-like
SwissprotQ9FLR32e-53NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A118JZL61e-55A0A118JZL6_CYNCS; No apical meristem (NAM) protein
TrEMBLW5D0961e-55W5D096_WHEAT; Uncharacterized protein
STRINGTraes_3B_9A0FAE972.12e-56(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3513624
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]