PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01666.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SRS
Protein Properties Length: 231aa    MW: 23756 Da    PI: 8.989
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01666.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702201.72.2e-62241842154
                        DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskk 82 
                                   +sg++sC dCGnqakk+Cah+RCRtCC+srgfdC thvkstWvpa +rrerqq + aa ++  +   + a+kr+r   +++
  Zmw_sc01666.1.g00120.1.am.mk  24 GSGGTSCYDCGNQAKKGCAHNRCRTCCNSRGFDCDTHVKSTWVPAVRRRERQQLAGAAGASPPS--PAGAAKRPRLACQTN 102
                                   57889**********************************************9999998777766..677889999999999 PP

                        DUF702  83 qsalsstklssaeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                                   + a s+t++s+a++++++etss          lP++v+ +a+frcv+v+svddg+ e+aYq+av+i+Gh+f+G+Lyd G+e
  Zmw_sc01666.1.g00120.1.am.mk 103 TGANSRTSTSNATTPRSFETSSshqdasfresLPRHVRGPALFRCVQVTSVDDGQREVAYQAAVTINGHLFRGLLYDLGAE 183
                                   999*****************9999*******************************************************98 PP

                        DUF702 154 e 154
                                   +
  Zmw_sc01666.1.g00120.1.am.mk 184 D 184
                                   6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.6E-5527183IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016237.2E-252971IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.9E-21135181IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
GSPGNKPPAV TDYGRGRADS GGSGSGGTSC YDCGNQAKKG CAHNRCRTCC NSRGFDCDTH  60
VKSTWVPAVR RRERQQLAGA AGASPPSPAG AAKRPRLACQ TNTGANSRTS TSNATTPRSF  120
ETSSSHQDAS FRESLPRHVR GPALFRCVQV TSVDDGQREV AYQAAVTING HLFRGLLYDL  180
GAEDARATSA AAQLGSSDLH LGSASANAAP DLYSGGSGPL ILGGLGYGNT P
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18835563}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269|PubMed:18835563}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962238.11e-101protein LATERAL ROOT PRIMORDIUM 1
RefseqXP_022680709.11e-101protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK93e-51LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLK3Z8B12e-99K3Z8B1_SETIT; Uncharacterized protein
STRINGSi022781m1e-100(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35793679
Publications ? help Back to Top
  1. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]