PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01626.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 241aa    MW: 26897.3 Da    PI: 6.7186
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01626.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.94.2e-49231552128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk........kvkaeekewyfFskrdkkyatgkrk 74 
                                    pGfrFhPtd+elv +yLk+kve+k +++ ++ike+d+yk +PwdLp+        +  a+ekewyfF+ r +ky+++ r+
  Zmw_sc01626.1.g00150.1.am.mk  23 FPGFRFHPTDQELVGFYLKRKVERKGFSI-DIIKEIDVYKRDPWDLPSeawpvvlaQGGAGEKEWYFFCLRGRKYRNSIRP 102
                                   69***************************.99**************95589988765556899****************** PP

                           NAM  75 nratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   nr+t sg+Wkatg dk++++ +ge vglkk+Lv+y g+a kg+ktdW+mhe+rl
  Zmw_sc01626.1.g00150.1.am.mk 103 NRVTGSGFWKATGIDKPIHD-GGECVGLKKSLVYYVGSAGKGTKTDWMMHEFRL 155
                                   ********************.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-5222159IPR003441NAC domain
PROSITE profilePS5100547.7222183IPR003441NAC domain
PfamPF023654.0E-2524155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEKKPMEESG STGVGGNEDD LVFPGFRFHP TDQELVGFYL KRKVERKGFS IDIIKEIDVY  60
KRDPWDLPSE AWPVVLAQGG AGEKEWYFFC LRGRKYRNSI RPNRVTGSGF WKATGIDKPI  120
HDGGECVGLK KSLVYYVGSA GKGTKTDWMM HEFRLRAATS FKSTTTDLSE AHHATLHCQP  180
FQLHGFHEVS PEEVTETKTS ATVGTSSPSA SGWSELTSFV PDAGSTCWDE LGRILEISPR  240
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-472415522145NAC domain-containing protein 19
3swm_B1e-472415522145NAC domain-containing protein 19
3swm_C1e-472415522145NAC domain-containing protein 19
3swm_D1e-472415522145NAC domain-containing protein 19
3swp_A1e-472415522145NAC domain-containing protein 19
3swp_B1e-472415522145NAC domain-containing protein 19
3swp_C1e-472415522145NAC domain-containing protein 19
3swp_D1e-472415522145NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443628.11e-81transcription factor JUNGBRUNNEN 1
RefseqXP_014660370.12e-81transcription factor JUNGBRUNNEN 1
SwissprotQ9SK555e-70NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A1E5WKN54e-87A0A1E5WKN5_9POAL; Transcription factor JUNGBRUNNEN 1
STRINGSb08g022560.14e-81(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119138129
Publications ? help Back to Top
  1. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  2. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  3. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  4. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]