PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01623.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 537aa    MW: 57937.8 Da    PI: 9.0123
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01623.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.1e-491002271128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrF P+deelv++yL+kkv+++++    ++ evd++  ePw+Lp  +k + ++wyfFs rd+kyatg+r+nratk+g
  Zmw_sc01623.1.g00090.1.am.mk 100 LPPGFRFFPSDEELVCHYLHKKVANERIAQ-GTLVEVDLHAREPWELPDVAKLTASDWYFFSFRDRKYATGSRTNRATKTG 179
                                   79*************************998.88***************77777889************************* PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+ev s  ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl
  Zmw_sc01623.1.g00090.1.am.mk 180 YWKATGKDREVRSPaTRAVVGMRKTLVFYHGRAPNGVKSGWVMHEFRL 227
                                   *************977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-5892246IPR003441NAC domain
PROSITE profilePS5100557.622100246IPR003441NAC domain
PfamPF023654.0E-27101227IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MMIKLARRSP GWFAHQLGSR VAFTAGKNIT SVAPAGLRAF DLGRLPRRDT ASCSSSSSSV  60
STRDRSVSVL ASADRDSPVD GRTAHHGNRA MALREIESTL PPGFRFFPSD EELVCHYLHK  120
KVANERIAQG TLVEVDLHAR EPWELPDVAK LTASDWYFFS FRDRKYATGS RTNRATKTGY  180
WKATGKDREV RSPATRAVVG MRKTLVFYHG RAPNGVKSGW VMHEFRLDTP CSSPREDWVL  240
CRVFEKTKGD GAADGHDSAS GASSSPTLTG SSSHVDAPER QEHHAPCGGY YGAGFAPQQE  300
VAVLLPCYGS YGPPAVDRHG FPQDDAGGAL PAGFEFGARE VAGDEYGFGY FDMAGFEDVG  360
NHGHGGMGQR VTAWCGTPSS LPAAYTCARP LAAGVKPPPP AALTVPYEEP EPTPAAACSG  420
CTWGLGNAVA RSSSPVTDTK DGGPREAAAA LGQARRRSNA PKQIEQGTQR THMLLDAILF  480
VDLTSCSWRR RRTNQRPADR PARHAGAGKN NSDLHCSPYQ HLQASKKIDM RGANICK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-479924619168NAC domain-containing protein 19
3swm_B6e-479924619168NAC domain-containing protein 19
3swm_C6e-479924619168NAC domain-containing protein 19
3swm_D6e-479924619168NAC domain-containing protein 19
3swp_A6e-479924619168NAC domain-containing protein 19
3swp_B6e-479924619168NAC domain-containing protein 19
3swp_C6e-479924619168NAC domain-containing protein 19
3swp_D6e-479924619168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953145.11e-121NAC domain-containing protein 79
TrEMBLK3YUQ51e-120K3YUQ5_SETIT; Uncharacterized protein
STRINGSi018001m1e-121(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166