PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01609.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 317aa    MW: 36175.2 Da    PI: 6.7977
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01609.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.72.5e-133263233
                                    XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLee 33
                                    +++k+ rr+++NReAAr+sR+RKka+i++Le+
  Zmw_sc01609.1.g00200.1.sm.mkhc 32 PPDKVLRRLAQNREAARKSRLRKKAYIQQLET 63
                                    5799**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-72772No hitNo description
SMARTSM003388.1E-73195IPR004827Basic-leucine zipper domain
PfamPF001703.9E-103364IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.2E-73568No hitNo description
PROSITE patternPS0003603853IPR004827Basic-leucine zipper domain
PfamPF141441.1E-27121194IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEADNKFDAR LEDVPHVAVE PARSTDQETS KPPDKVLRRL AQNREAARKS RLRKKAYIQQ  60
LETSRIKLAQ LEQDIVRARQ QGVYANGNMG DSTLGFTGSL DPGVASFEID YNHWVDEQNR  120
HTRELRNALQ GQTSELELRM LVETGLSNYE HLFDIKSIAA QSDVFYIMSG MWKTSVERFF  180
LWIGGFRPSE VLKLEPLTDA QRMAVCRLQQ TSTQAEDALF QGMEKLQQNV METLTVVDPI  240
APAEAYMLQM TNAVDKLKEL VGFVIQADHL RLTTLQQMHK ILTTQQAARG LLALGDYFQR  300
LRTLSQLWAC DALNRRC
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in defense response. {ECO:0000250|UniProtKB:Q7X993}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823704.10.0transcription factor TGAL6-like isoform X2
RefseqXP_025823705.10.0transcription factor TGAL6-like isoform X2
SwissprotA0A0P0WFC81e-156TGAL6_ORYSJ; Transcription factor TGAL6
TrEMBLA0A0A9D9I60.0A0A0A9D9I6_ARUDO; Uncharacterized protein
STRINGPavir.Ga00349.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35713877
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Okada A, et al.
    OsTGAP1, a bZIP transcription factor, coordinately regulates the inductive production of diterpenoid phytoalexins in rice.
    J. Biol. Chem., 2009. 284(39): p. 26510-8
    [PMID:19635799]
  3. Okada K
    The biosynthesis of isoprenoids and the mechanisms regulating it in plants.
    Biosci. Biotechnol. Biochem., 2011. 75(7): p. 1219-25
    [PMID:21737944]
  4. Yamane H
    Biosynthesis of phytoalexins and regulatory mechanisms of it in rice.
    Biosci. Biotechnol. Biochem., 2013. 77(6): p. 1141-8
    [PMID:23748776]
  5. Miyamoto K, et al.
    Identification of target genes of the bZIP transcription factor OsTGAP1, whose overexpression causes elicitor-induced hyperaccumulation of diterpenoid phytoalexins in rice cells.
    PLoS ONE, 2014. 9(8): p. e105823
    [PMID:25157897]
  6. Miyamoto K, et al.
    Overexpression of the bZIP transcription factor OsbZIP79 suppresses the production of diterpenoid phytoalexin in rice cells.
    J. Plant Physiol., 2015. 173: p. 19-27
    [PMID:25462074]