PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01589.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 380aa    MW: 40478.1 Da    PI: 10.5052
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01589.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.92.2e-13239282548
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                                   +r+rr++kNRe+A rsR+RK+a++ eLe +v+ L++ N +L+k+
  Zmw_sc01589.1.g00050.1.sm.mk 239 RRQRRMIKNRESAARSRARKQAYTMELEAEVQMLKEINAELQKK 282
                                   79*************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-11235301IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.496237282IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11239282No hitNo description
Gene3DG3DSA:1.20.5.1702.7E-14239282No hitNo description
CDDcd147074.80E-25239291No hitNo description
PfamPF001707.8E-12239282IPR004827Basic-leucine zipper domain
PROSITE patternPS000360242257IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MDPKDGERRG PLARQGSIYS LTFDEFQSTL GGMAGGGLGK DFGSMNMDEL LRSIWTAEES  60
QAMASASGSG TAALGAGDDG ALQRQGSLTL PRTLSVKTVD EPTLGEMTLE EFFVRAGVVR  120
ENPAAAGFPA PIQAVNNGSS IFFGNFGGAA SDTGAGAMGF APVGIGDPSA MGNGLMPGMA  180
GMGGAAVTVS PVDTSVAQLD SVGKGNSDLS SPMAPLPYPF EGVIRGRRSG AGVEKVVERR  240
QRRMIKNRES AARSRARKQA YTMELEAEVQ MLKEINAELQ KKQVLEAVSN PYAQKKRCLR  300
RTLTGPCLPG QSLSRCVNST RFCAVILHYP YGTGDRLLKL IAVRKPDRRT TWVDRVSDSA  360
SGQRRKGRRL FSRRPRAAKP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1362368QRRKGRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973666.11e-151bZIP transcription factor TRAB1
SwissprotQ6ZDF31e-125TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLK3YIB01e-149K3YIB0_SETIT; Uncharacterized protein
STRINGSi013904m1e-135(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]