PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01571.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 430aa    MW: 45556.8 Da    PI: 9.5703
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01571.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.41.3e-30188264681
                           TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec.eaesssss 81 
                                    rh ++hTkv+gR+RR+Rl   caar+  L++eLG++ d++ti WLlqq++pa++++tgt++ +  ++  +++++  
  Zmw_sc01571.1.g00090.1.am.mk 188 PRHRDRHTKVEGRGRRIRLAEACAARIARLTRELGHKNDGETIRWLLQQSEPAVIAATGTGTVPXXAAvADGDQQPD 264
                                   69**********************************************************88888444222222221 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.8E-24190255IPR005333Transcription factor, TCP
PROSITE profilePS5136921.597190244IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MVQKIIETEQ KSKSRTRPKT GAAKSKQRRR IEEAGARDES ASSPNPISLG VAXXXISSGP  60
VGRLPLNPTL RDPLSQRRSK NRSRELAQRR APPNQNKGAE SKKPERETKA RLAPIRSPLE  120
SRAPDMGEED VAAFYHAAGN GTAVTDAAVV GIDAMGSSEA HGSLMPKPEP APVEFLGELQ  180
VANPRPAPRH RDRHTKVEGR GRRIRLAEAC AARIARLTRE LGHKNDGETI RWLLQQSEPA  240
VIAATGTGTV PXXAAVADGD QQPDPKRRRK LQPTRAAAAG ATAPPLTSTP TAYYPVVADP  300
LLQGNGGGAI STSSGLAPAS VPTPPPGAIP FLAIPAPGPG ATIDGKQMMK PTAVWMVPPQ  360
AGAGGAANQP THYWAFPTNP ELFGNFQQQA VYDAGQLVDG GESQHQQLEG HQDGEGEEED  420
IALTESSSEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264270PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803340.11e-124transcription factor PCF2-like
SwissprotA2YXQ11e-70PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-70PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A2T7EUU11e-123A0A2T7EUU1_9POAL; Uncharacterized protein
STRINGSb02g030260.11e-117(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]