PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01560.1.g00220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 153aa    MW: 18276.2 Da    PI: 10.3589
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01560.1.g00220.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.3e-5381351128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   + pGfrFhPtde lv  yL++k+++k+l++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t++g
  Zmw_sc01560.1.g00220.1.am.mk   8 MLPGFRFHPTDEKLVRLYLERKIQQKSLPI-ELIRQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSTRPNRVTRAG 87 
                                   579***************************.89***************9888999************************** PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +Wkatg+d++++s+ +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  Zmw_sc01560.1.g00220.1.am.mk  88 FWKATGTDRPIYSSdRSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 135
                                   *************967778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-546140IPR003441NAC domain
PROSITE profilePS5100551.3578153IPR003441NAC domain
PfamPF023651.4E-2510135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MEKQEEVMLP GFRFHPTDEK LVRLYLERKI QQKSLPIELI RQLDIYKYDP WDLPKLASTG  60
EKEWYFYCPR DRKYRNSTRP NRVTRAGFWK ATGTDRPIYS SDRSKCIGLK KSLVFYKGRA  120
AKGVKTDWMM HEFRLPSLTD PSLQQKKPLE KTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-521013517140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454285.11e-104putative NAC domain-containing protein 94
RefseqXP_020171862.11e-104putative NAC domain-containing protein 94
SwissprotQ9FIW54e-85NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A287UQU31e-103A0A287UQU3_HORVV; Uncharacterized protein
STRINGSb04g028015.11e-103(Sorghum bicolor)
STRINGTraes_6BL_A169A3ECB.11e-103(Triticum aestivum)
STRINGTraes_6DL_DA233B945.11e-103(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137172629