PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01551.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 832aa    MW: 90512.8 Da    PI: 10.0822
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01551.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM132.23.6e-41131432127
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknrat 78 
                                   ppGfrF Pt+eel+ +yL+++++g++ ++e++i+ vdiy+++P+dL++    +  ++ ++w+fF++r++++ +g r+ r+t
  Zmw_sc01551.1.g00060.1.am.mk  13 PPGFRFYPTEEELLGFYLRQRLAGTRPDVERFIPVVDIYSYHPRDLQSlagaANVSDPEQWFFFCPRAERELHGGRPARTT 93 
                                   9****************************999**************9545532223556********************** PP

                           NAM  79 ksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyr 127
                                    sgyWkatg+   v+s+  ++++g k+t+vfy+grap+g+kt+W m+ey+
  Zmw_sc01551.1.g00060.1.am.mk  94 PSGYWKATGSPSWVFSSsANRVIGEKRTMVFYQGRAPTGTKTRWKMNEYK 143
                                   ***************9867788***************************8 PP

2bZIP_129.12.2e-09745807163
                                   XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke ++   e+ +lk  +
  Zmw_sc01551.1.g00060.1.am.mk 745 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNESMKKEKDMVMREYLSLKEAN 807
                                   89**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-4510170IPR003441NAC domain
PROSITE profilePS5100548.04412171IPR003441NAC domain
PfamPF023657.8E-2213143IPR003441NAC domain
Gene3DG3DSA:1.20.5.1702.4E-5743810No hitNo description
SMARTSM003382.3E-12745809IPR004827Basic-leucine zipper domain
PfamPF001702.0E-7745808IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.174747810IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.7E-6749805No hitNo description
CDDcd147021.50E-13750800No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 832 aa     Download sequence    Send to blast
METTGGGVDP IFPPGFRFYP TEEELLGFYL RQRLAGTRPD VERFIPVVDI YSYHPRDLQS  60
LAGAANVSDP EQWFFFCPRA ERELHGGRPA RTTPSGYWKA TGSPSWVFSS SANRVIGEKR  120
TMVFYQGRAP TGTKTRWKMN EYKAVADPAV TVAVVPPRLR NEFSVCRVYI STGTLRSFDR  180
RPLNHADIHH HHQLVLPPPA ANTGSTQPFG GDVVANGNGQ TETSRDSSSF GSRGMVVDGD  240
NAIDWDSLMI PLADDGLSFS AEGLARATQK QSERNAHDTH TWPRKARPIE ITIIGNLPKQ  300
TGSGPSPSAA RRRKGSTAAC PHRRARARHD HRAELFSTVG SDPGSAAPRA QTVGSDPGSA  360
ASYQSVGFRA CTALSVRPWP AHRHTLSLMW PSARNTPNKR VPRRRVNPAY WSGTASPTCM  420
RSLTLCDLPP ARNWPSPARE WQVAHARQTP TCAAAAAAAA ADRPITLSSE PRRPATIHAS  480
GPHVVTVVAG VRRGDMIVYC ARQAGTPRLS PSLQFTPPIP SRSSSMDIST TRDVNSRLAI  540
GPLLRRAAVP AGRYGGLHPH GGVARLYGHV AAADGRDGPP PGPSDARREV PEDHLSCPPA  600
PARTASGNQI FNLRSHEIEI DRCQSPVMSE DSDGQRPCRR GVNVHELDAA MALADMAGVG  660
PDQQQQQQPQ PPPAAPQAER EDEELASTRL SLELGKVGIQ SSPCSSSSSA GHHHPAPQQQ  720
PPLMPAAAAV SGYGPRPRHM LTEAEKEAKR LRRVLANRES ARQTILRRQA IRDELARKVA  780
DLSSQNESMK KEKDMVMREY LSLKEANKQL KEQADLSLSV LALIHPSSSC YL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-27916913166NAC domain-containing protein 19
3swm_B6e-27916913166NAC domain-containing protein 19
3swm_C6e-27916913166NAC domain-containing protein 19
3swm_D6e-27916913166NAC domain-containing protein 19
3swp_A6e-27916913166NAC domain-containing protein 19
3swp_B6e-27916913166NAC domain-containing protein 19
3swp_C6e-27916913166NAC domain-containing protein 19
3swp_D6e-27916913166NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140