PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01549.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CAMTA
Protein Properties Length: 591aa    MW: 67408.2 Da    PI: 9.229
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01549.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1172.94.4e-54121273117
                            CG-1   3 ke.kkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvev 80 
                                     +e ++rwl++ e++ iL+n+e++ +t e++++p+sgsl+Lynr++ ryfr DG+ w++kkdg+tv E+he+LKvg+v++
  Zmw_sc01549.1.g00090.1.am.mkhc  12 EEaRTRWLRPAEVYYILQNHERFPITPEPPKKPPSGSLFLYNRRVNRYFRGDGHAWRRKKDGRTVGEAHERLKVGNVDA 90 
                                     5569*************************************************************************** PP

                            CG-1  81 lycyYahseenptfqrrcywlLeeelekivlvhylev 117
                                     l+cyYah+e+np fqrrc+w+Le  +e+ivlv+y++v
  Zmw_sc01549.1.g00090.1.am.mkhc  91 LSCYYAHGEQNPCFQRRCFWMLEPVYEHIVLVQYRDV 127
                                     ***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143778.7157133IPR005559CG-1 DNA-binding domain
SMARTSM010761.6E-6810128IPR005559CG-1 DNA-binding domain
PfamPF038593.9E-4613127IPR005559CG-1 DNA-binding domain
SuperFamilySSF812961.49E-10174236IPR014756Immunoglobulin E-set
PfamPF018337.7E-5175236IPR002909IPT domain
CDDcd002043.10E-14228313No hitNo description
SuperFamilySSF484033.26E-14228315IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.8E-14241314IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029714.186241313IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008810.766254286IPR002110Ankyrin repeat
SMARTSM002485.2E-4254283IPR002110Ankyrin repeat
PfamPF136371.9E-5256312No hitNo description
SMARTSM002482800293322IPR002110Ankyrin repeat
SMARTSM0001527374396IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.602375404IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.712435464IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525402.26E-6435482IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001517436456IPR000048IQ motif, EF-hand binding site
PfamPF006120.0082437455IPR000048IQ motif, EF-hand binding site
SMARTSM000151.7E-6457479IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.64458486IPR000048IQ motif, EF-hand binding site
PfamPF006127.5E-6459479IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MSESFDINVL REEARTRWLR PAEVYYILQN HERFPITPEP PKKPPSGSLF LYNRRVNRYF  60
RGDGHAWRRK KDGRTVGEAH ERLKVGNVDA LSCYYAHGEQ NPCFQRRCFW MLEPVYEHIV  120
LVQYRDVAES DSQFQQKLEY QPPGSLDSSD LRIKLSAAKR ADTRLALGQN RLFNIREISP  180
EWAFSYEITK VIITGDFLCD PLSSYWAVMF GDSAVPAEMV QPGVLRCYTP LHSFEWALSS  240
VLSAGVGINF RDSNGWTALH WAAYFGREKM VATILAAGAS ATAVTDPTAQ DPVGKTAAFL  300
ASERGHMGLA GYLSEVSLTS HLASLTIEES EISKGSAAVE AERAVESISQ RSAKRQGGTE  360
DELSMKDSLA AVRNAAQAAA RIQNAFRAFS FRKRQQKTAR LRDEYGMTQE DIDELAAAAA  420
SRSYHQNHAL NGQFYDKAAV SIQKKYKGWK GRKHFLNMRR NAVKIQAHVR GHQVRKKYKT  480
FVSTVSVLEK VILRWRRRRQ GLRGFRAEQP TMIVAEEEEE EDDDDVDFED DEATRMFRRQ  540
KVDEALKEAV SRVLFMVESP EARMQYRRML EEFRQATGLC HIDMSAIRSR S
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239810.11e-172PREDICTED: calmodulin-binding transcription activator 4 isoform X2
SwissprotQ9FYG28e-97CMTA4_ARATH; Calmodulin-binding transcription activator 4
TrEMBLA0A0E0KPU01e-176A0A0E0KPU0_ORYPU; Uncharacterized protein
TrEMBLA0A0E0KPU11e-176A0A0E0KPU1_ORYPU; Uncharacterized protein
STRINGBRADI5G08167.11e-172(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62383241