PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01546.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 279aa    MW: 31408.3 Da    PI: 5.7082
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01546.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.12.4e-51161411128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeelv +yL+++++g+  ++  +i+e+d+y+++PwdLp+++  +++ewyfF++rd+ky++g+r+nra+ 
  Zmw_sc01546.1.g00030.1.sm.mkhc  16 LPPGFRFHPTDEELVAHYLCARAAGRAPPV-PIIAELDLYRFDPWDLPARALFGRREWYFFTPRDRKYPNGSRPNRAAG 93 
                                     79*************************999.88***************87778999*********************** PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     sgyWkatg dk+v + +g++vg+kk Lvfy+g+ p+g kt+W+mheyrl
  Zmw_sc01546.1.g00030.1.sm.mkhc  94 SGYWKATGADKPVAH-RGRTVGIKKALVFYHGKPPRGGKTEWIMHEYRL 141
                                     ***************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-6212168IPR003441NAC domain
PROSITE profilePS5100559.49516168IPR003441NAC domain
PfamPF023652.7E-2717141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MATTTRRRDA EAELNLPPGF RFHPTDEELV AHYLCARAAG RAPPVPIIAE LDLYRFDPWD  60
LPARALFGRR EWYFFTPRDR KYPNGSRPNR AAGSGYWKAT GADKPVAHRG RTVGIKKALV  120
FYHGKPPRGG KTEWIMHEYR LADDAGRRKP GNGSLRLDDW VLCRLYNKKN EWEKMQEQKE  180
MGMEASHSQS FGDTRTPESE IDELDQLPAF GDIGAVMPKE EVQEVDDLGF GGADDWLTGI  240
NLDDLQGLCP MPGDDFYSSV LLTPTPAKAE QGGAGLFYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-9561745174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt and cold stresses (PubMed:18813954, PubMed:20632034). Induced by dehydration and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804128.11e-146NAC domain-containing protein 67-like
SwissprotQ7EZT11e-123NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLA0A0A9D6V81e-158A0A0A9D6V8_ARUDO; Uncharacterized protein
STRINGSb02g006680.11e-144(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  3. Ghosh T,Rai M,Tyagi W,Challam C
    Seedling stage low temperature response in tolerant and susceptible rice genotypes suggests role of relative water content and members of OsSNAC gene family.
    Plant Signal Behav, 2016. 11(5): p. e1138192
    [PMID:26829663]
  4. Rahman H,Ramanathan V,Nallathambi J,Duraialagaraja S,Muthurajan R
    Over-expression of a NAC 67 transcription factor from finger millet (Eleusine coracana L.) confers tolerance against salinity and drought stress in rice.
    BMC Biotechnol., 2016. 16 Suppl 1: p. 35
    [PMID:27213684]