PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01544.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 353aa    MW: 38651.6 Da    PI: 7.559
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01544.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.2e-52161501129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdee+v+ yL +k  + +++  ++i+ev+++k+eP+dLp+k+k +ekewyfF+++d ky+tg r+nratk
  Zmw_sc01544.1.g00160.1.sm.mkhc  16 LPPGFRFHPTDEEVVTSYLLRKFLNPSFDP-RAIAEVNLNKCEPRDLPSKAKMGEKEWYFFCHKDMKYPTGMRTNRATK 93 
                                     79*************************999.88***************99999************************** PP

                             NAM  80 sgyWkatgkdkevlsk.......kgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     +gyWkatgkd+e+++        ++elvg+kktLvfy+grap+g+kt+Wvmhe+rle
  Zmw_sc01544.1.g00160.1.sm.mkhc  94 EGYWKATGKDREIFKPvsdggsgRRELVGMKKTLVFYTGRAPRGSKTNWVMHEFRLE 150
                                     ***************999999888888***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.15E-5913176IPR003441NAC domain
PROSITE profilePS5100555.3916176IPR003441NAC domain
PfamPF023651.0E-2717149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MVERGVVKQE QGDLFLPPGF RFHPTDEEVV TSYLLRKFLN PSFDPRAIAE VNLNKCEPRD  60
LPSKAKMGEK EWYFFCHKDM KYPTGMRTNR ATKEGYWKAT GKDREIFKPV SDGGSGRREL  120
VGMKKTLVFY TGRAPRGSKT NWVMHEFRLE GKYRDTANLV HLTPKDEWVV CKVFHKSNGE  180
DNKKAAAAAG AGDGGDDVLV DSTIDPVCFE YSTSCLLDTT TTTTTTMDVT AMAPYDAAAM  240
LTNVVGSFVD DLPNYTLIGD TTSSSRRNLH QHQTTTVAGS TAVPASSGYS SPWTTNTLRP  300
DYSYLAMGSY DLLDQAMTAK ALGLGGVVSP AVAGGLPSYP VAGTSQRSSL GHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-491317817170NAC domain-containing protein 19
3swm_B6e-491317817170NAC domain-containing protein 19
3swm_C6e-491317817170NAC domain-containing protein 19
3swm_D6e-491317817170NAC domain-containing protein 19
3swp_A6e-491317817170NAC domain-containing protein 19
3swp_B6e-491317817170NAC domain-containing protein 19
3swp_C6e-491317817170NAC domain-containing protein 19
3swp_D6e-491317817170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response (By similarity). Binds to DNA-specific sequences of CLPD1 and OAT promoters in vitro (PubMed:18813954). {ECO:0000250|UniProtKB:Q7F2L3, ECO:0000269|PubMed:18813954}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt and cold stresses. {ECO:0000269|PubMed:18813954}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977422.11e-130NAC domain-containing protein 77
SwissprotQ5CD173e-92NAC77_ORYSJ; NAC domain-containing protein 77
TrEMBLK3Y8761e-128K3Y876_SETIT; Uncharacterized protein
STRINGSi010417m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51203063