PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01542.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 291aa    MW: 31787.5 Da    PI: 6.8503
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01542.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353.1e-11158203550
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                                   kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Zmw_sc01542.1.g00160.1.am.mk 158 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 203
                                   8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.9E-14154218IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76156212IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.55E-11158212No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-14158212No hitNo description
PfamPF001704.6E-10158208IPR004827Basic-leucine zipper domain
CDDcd147033.03E-24159209No hitNo description
PROSITE patternPS000360161176IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAQLPPKVPT MAPAWPEFGG AHHHHQHQRS PSVGALLAAA PMPPLPPQHA QQQPSWVDEF  60
LDFSAAKRGA HRRTVSDDNA GVGAHEFDRL DDDQLLSMFA DDLAPPIPQT APAQSSSSPS  120
DHNSFNDEKP EKGEKEEAQS KCKGDGAASA APAPVDPKRV KRILANRQSA QRSRVRKLQY  180
ISELERSVTS LQTEVSALSP RVAFLDHQRS LLTLGNSHLK QRIAALAQDK IFKDAHQEAL  240
KKEIQRLRQI YHQQVLQNAE SPTTDDPPIR SDEDVLIAAS EGTAAAPCPP S
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by dehydration and salt stress. {ECO:0000269|PubMed:18065552}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817786.11e-136basic leucine zipper 2-like
SwissprotQ5QNI51e-99BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLA0A2S3HYX31e-134A0A2S3HYX3_9POAL; Uncharacterized protein
TrEMBLA0A2T7DSS51e-134A0A2T7DSS5_9POAL; Uncharacterized protein
STRINGSi002311m1e-133(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]