PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01533.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 877aa    MW: 93924.6 Da    PI: 9.0783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01533.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1676.4e-524475751128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat
  Zmw_sc01533.1.g00200.1.am.mk 447 VPPGFRFHPTEEELLTYYLKKKVASERIDL-DVIRDVDLNKLEPWDIQEkcRIGSgPQNDWYFFSHKDKKYPTGTRTNRAT 526
                                   69****************************.9***************952444443456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk+++s  ++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Zmw_sc01533.1.g00200.1.am.mk 527 AAGFWKATGRDKAIYS-CTRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 575
                                   ****************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-53442577IPR003441NAC domain
PROSITE profilePS5100551.483447677IPR003441NAC domain
PfamPF023652.7E-27448575IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 877 aa     Download sequence    Send to blast
MGDERSSSSL TEFASTARSR RAEYRSSYMS PPAGCSGFVL LSRCAVATSN SRREISAEER  60
EGGHDRSSAP LLSQPEKGKG ELAIEGIDRH HNANKHHAVL LACRYTSIIC PETRDWTTSS  120
VSFLGTASTG ARSAAGEQRR CRAPCAGGGD RNIITSGLRP PPPPPPPPPG RWGGDADAAR  180
DRYTLTAIKR TGFTGHDAAF MGIGERECYY YAYSNYVALR ADYHLTDGCN SPASTAVCED  240
PDGTDTPRDY HRSYTHQTRQ TASPAISADS DGQRYGRAKR KATATRGTVQ SLEKNTGISF  300
SVAVAGAVIV VAVVAAVVTL AIPGTHATAA QHHSIDGRVI LPRPAGVTRR RFRLAMLFRR  360
FLRSCVMALD GAPSPFPRPL PHAPPVATHR LPPSLPPFLP PRPGWRGPPS SLAPHCIVGF  420
SLFAFSLMVG GTSLASAKLI PLGSSAVPPG FRFHPTEEEL LTYYLKKKVA SERIDLDVIR  480
DVDLNKLEPW DIQEKCRIGS GPQNDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI  540
YSCTRRIGMR KTLVFYKGRA PHGQKSDWIM HEYRLDDVQT PAAGVDPYYP SPPPPPALEL  600
GLGVPGLLVE ISVAGGEVVG LGSPRKATEF GHQQDHQTCV SKGQPKTAGR VRMRGGAAAG  660
DQAAQEEGWV ICRVFKKKNL VLHHGQSSGG GGTTTAATAA SKTAAATTME SSPTSNGSSV  720
TVTDQVKAQL LHSASDDALD HILQYIGRSC HTNNEQDTKP PPALQLDHHL AATTATACPA  780
GSSFYGRFMK LPPLEHVGAG LLPNPAGYAA DASGIADWDS LDRLAAYEFN GLSDASKNMV  840
AFLDEPNAAA GTGDGDLWSL ARSSVSSLHP DLTRNNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-4344757515140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025810838.11e-157NAC domain-containing protein 43-like
TrEMBLA0A2S3HM671e-155A0A2S3HM67_9POAL; Uncharacterized protein
STRINGSb10g002120.11e-148(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112