PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01514.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 338aa    MW: 37428.3 Da    PI: 6.1973
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01514.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-1969123256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                    k++++ ++q+ +Le++Fe + +++ e+++++A+ l+L  rqV vWFqNrRa++k
  Zmw_sc01514.1.g00070.1.am.mk  69 EKKRRLAADQVSALERCFEADDKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 123
                                   6778999***********************************************9 PP

2HD-ZIP_I/II124.54.9e-4069161193
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   ekkrrl+++qv++LE++Fe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal++e ++L+
  Zmw_sc01514.1.g00070.1.am.mk  69 EKKRRLAADQVSALERCFEADDKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFNALRSRHDALHHECDELR 149
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelke 93 
                                   +++++L++e++e
  Zmw_sc01514.1.g00070.1.am.mk 150 RDKDALAAEIRE 161
                                   *******99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-1950126IPR009057Homeodomain-like
SuperFamilySSF466894.71E-1860127IPR009057Homeodomain-like
PROSITE profilePS5007116.84465125IPR001356Homeobox domain
CDDcd000862.05E-1568126No hitNo description
SMARTSM003896.9E-1868129IPR001356Homeobox domain
PfamPF000461.4E-1668123IPR001356Homeobox domain
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PfamPF021835.0E-14125166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MKRPSCRGSS VASQGTQERE SEDSSRYMER QGLDVHGTVD VVASAGTYGD VEEDEDELEL  60
AGGRGGLREK KRRLAADQVS ALERCFEADD KLDPERKARI ARDLRLHPRQ VAVWFQNRRA  120
RWKTKQIERD FNALRSRHDA LHHECDELRR DKDALAAEIR ELREKVEKQM AVKLESMEDR  180
PLQAVTTVYK DGSTDSDSSA VFNEEASPYS GGAAFDHHPS FNGFTSFLAS SSALGSSFPS  240
MYSGGPHLDQ PEADGFLGPV ATTDGFFAEE QGTGLGGWYG GDGWRTGPTS QLLPAAQRPP  300
PFSFLCPSHQ AEAGRICMAR RRLNRAQRSP SDAVATHR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792352.11e-111homeobox-leucine zipper protein HOX8-like isoform X1
SwissprotQ338Z72e-84HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A0A9JEK41e-118A0A0A9JEK4_ARUDO; Uncharacterized protein
STRINGPavir.J35191.1.p1e-112(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]