PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01456.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 201aa    MW: 22479.4 Da    PI: 6.6107
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01456.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1034.1e-3271241128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGf+F P+deelvv++L++k++  +++  ++i+ v +++++Pw+L+ ++ +  ++wyfFs++ +        +r+t 
  Zmw_sc01456.1.g00100.1.sm.mkhc   7 LPPGFHFFPSDEELVVQFLHRKASLLPCQP-DIIPIVPLNQHDPWELNGRALEAGNQWYFFSNATR--------SRVTP 76 
                                     79*************************999.99**************976667789******9866........699** PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +gyW+    d+ v s +g +vglkktLvf   + +kg +t+Wvmhey+l
  Zmw_sc01456.1.g00100.1.sm.mkhc  77 NGYWNPICADEMVSS-GGCNVGLKKTLVFTVRQPSKGIQTNWVMHEYNL 124
                                     *************99.99************999**************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-424163IPR003441NAC domain
PROSITE profilePS5100537.8537165IPR003441NAC domain
PfamPF023655.9E-218124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MVGPSDLPPG FHFFPSDEEL VVQFLHRKAS LLPCQPDIIP IVPLNQHDPW ELNGRALEAG  60
NQWYFFSNAT RSRVTPNGYW NPICADEMVS SGGCNVGLKK TLVFTVRQPS KGIQTNWVMH  120
EYNLLDGSCK GSGSRINSSS KRLHKKKSHP KADCNNWVVC RVFDSSCGSK VSFHEEGTEL  180
SCLDEVFLSL DDYDEVSLTS K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-35717017170NO APICAL MERISTEM PROTEIN
1ut4_B2e-35717017170NO APICAL MERISTEM PROTEIN
1ut7_A2e-35717017170NO APICAL MERISTEM PROTEIN
1ut7_B2e-35717017170NO APICAL MERISTEM PROTEIN
3swm_A2e-35717020173NAC domain-containing protein 19
3swm_B2e-35717020173NAC domain-containing protein 19
3swm_C2e-35717020173NAC domain-containing protein 19
3swm_D2e-35717020173NAC domain-containing protein 19
3swp_A2e-35717020173NAC domain-containing protein 19
3swp_B2e-35717020173NAC domain-containing protein 19
3swp_C2e-35717020173NAC domain-containing protein 19
3swp_D2e-35717020173NAC domain-containing protein 19
4dul_A2e-35717017170NAC domain-containing protein 19
4dul_B2e-35717017170NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144148KKKSH
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823281.11e-107NAC domain-containing protein 104-like isoform X1
SwissprotQ8GWK62e-59NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A3L6PXI41e-106A0A3L6PXI4_PANMI; NAC transcription factor 29-like
STRINGPavir.Ga01785.1.p1e-105(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]