PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01446.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 529aa    MW: 55281.8 Da    PI: 7.9786
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01446.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.4e-28249298251
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Zmw_sc01446.1.g00060.1.sm.mk 249 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 298
                                   9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.4E-13246299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-25247298IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-21249299IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPNS SAPGSGPAGG RAAAGGAGGG GVGGDPWRRL NWSTELSLSP  60
PAEPDADALP LRHRPSAAAS SSAATTSSAR MMPMPTLQPL DAGGGGGGGG ASAAPPIRGI  120
PIYNGPGGFP FLPPAAGGDH QKVRFYGSYH HPATWPSSLG STSPSPLAPG ASPLDPASAF  180
LSPAVHHHHR MLSASGRLNG MLTDTLRGYG SAGGLGGIGG HHHLHGAQPF GLGSRFMPKL  240
PAKRSMRAPR MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQVR  300
GCRPPLPLNS PKTRAFCFVY LLPFLFLFGS DKNANAVTPE LVNDGETDDG WRLAAKKLSF  360
LGEREREERE RCMMYRTVKS TDKPAASSGP ADGGSGDDEF SGAGQTASGG DNNMCARPFG  420
EHRSTSEGAA SSVGRGGDMD QSTAGNTSTR WSNSSRDPWM SLNSCNMDAH RLVDLSSPIE  480
NAEPCRSSSS QVSNQEPSSP SLEFTLGRPD WQGPPIMNEP AIEELKLKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956748.11e-162probable transcription factor RL9
SwissprotQ0J2359e-77ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A3L6DY091e-166A0A3L6DY09_MAIZE; Putative transcription factor RL9
STRINGSi032049m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787