PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01444.1.g00270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 677aa    MW: 70993.5 Da    PI: 8.6641
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01444.1.g00270.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.51.2e-963106772374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                   ++lL e+A a+++g+ e a + La l+  a+p+gd  qRl+a+++ AL++r+a       ++ p+++ +e    e+ +  +
  Zmw_sc01444.1.g00270.1.am.mk 310 RQLLSEAAVAIADGNIETAATQLAALKRAANPRGDVEQRLIAMMVAALSSRIAP-----TASAPAQHLAELCGLEQRNGSQ 385
                                   789**************************************************9.....4455666666566778888889 PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeele 159
                                    +++ sP+++++  +aN aI+eav  ++++H++Dfd+s + Q +aL+q La+R+ +  sl++T+v +p+s     ++ +l 
  Zmw_sc01444.1.g00270.1.am.mk 386 HLHDRSPCFRLALYAANVAIVEAVGDHRAIHVVDFDVSAP-QHAALIQYLAERRVPGTSLKVTAVTDPSSPftqsQTATLP 465
                                   9************************************987.99************************998889989999** PP

                          GRAS 160 etgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvv 240
                                   ++gerL+k+A++ g++ +f++ v+ r ++l+  +L ++pgEalaVnl+++l +++desvs +++rde+L+ v+ l ++vv+
  Zmw_sc01444.1.g00270.1.am.mk 466 AVGERLKKLADRAGIEYHFKM-VSCRAAELDAAKLGLEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGAQVVT 545
                                   ********************9.7999******************************************************* PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                   +veqe+++n++++++rf++a+ yy a++dslea+l+res er++ E + l++++ n+v  ega+r er+e ++kWr+r+++
  Zmw_sc01444.1.g00270.1.am.mk 546 LVEQELNTNTAPLAARFTDACAYYGAILDSLEATLGRESAERAMAESA-LAKKAANAVGREGADRLERCEVFGKWRARFGM 625
                                   ***********************************************9.9******************************* PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   aGF+pv+ls ++a+q+ + +   + +g++++ e+g l lgW++r ++++SaWr
  Zmw_sc01444.1.g00270.1.am.mk 626 AGFRPVALSPSIADQVVARVGPAP-QGFTMKPENGVLRLGWMGRVVTVASAWR 677
                                   ***********************9.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.193283658IPR005202Transcription factor GRAS
PfamPF035144.1E-94310677IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MPWGPAITPP DKHQRTHHHH SAAWATPSAG VPPNGVGSAV SKHSSRRLPP SSRLPSLSLP  60
PCMEPGAPWR DPRQGYAYGL GSAMQIPMQQ QRPDAVGAGG VLKRSLGELE RWQHQQVAAQ  120
QALYLRAVRQ RTAAAALLGG APSHQPMVLP GSSYGGALAS PSSTLSSLST ASGAAVPLMQ  180
PQMHRQVPLM VSSAQQTQAL GVSRAPPPPP ASSSDMFLLQ ELEKQLLGDD DEPVAAMSGT  240
GSAVTNSEWE ETIQQLNSIT AGASPVVPAP VTPNNNAAGM TRSPSNSSSS TASSSASCSP  300
PTPGAAAATR QLLSEAAVAI ADGNIETAAT QLAALKRAAN PRGDVEQRLI AMMVAALSSR  360
IAPTASAPAQ HLAELCGLEQ RNGSQHLHDR SPCFRLALYA ANVAIVEAVG DHRAIHVVDF  420
DVSAPQHAAL IQYLAERRVP GTSLKVTAVT DPSSPFTQSQ TATLPAVGER LKKLADRAGI  480
EYHFKMVSCR AAELDAAKLG LEPGEALAVN LAFALSHVPD ESVSPANPRD ELLRRVRALG  540
AQVVTLVEQE LNTNTAPLAA RFTDACAYYG AILDSLEATL GRESAERAMA ESALAKKAAN  600
AVGREGADRL ERCEVFGKWR ARFGMAGFRP VALSPSIADQ VVARVGPAPQ GFTMKPENGV  660
LRLGWMGRVV TVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-3932867722375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK7UKW80.0K7UKW8_MAIZE; Uncharacterized protein
STRINGGRMZM2G173429_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474