PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01415.1.g00190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 227aa    MW: 23593.4 Da    PI: 10.636
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01415.1.g00190.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.53.7e-23179227149
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                                     +Cqv++C+adl++ak+yhrrhkvCe+hsk++++lv++++qrfCqqCsrf
  Zmw_sc01415.1.g00190.1.sm.mkhc 179 MCQVDDCRADLTSAKDYHRRHKVCETHSKTTKALVANQMQRFCQQCSRF 227
                                     6***********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-25173227IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.307177227IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.54E-22178227IPR004333Transcription factor, SBP-box
PfamPF031109.8E-17180227IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MQREVGPQVA PPLFLHQIQQ LPPHAAAAKK RGHPWPAVPP AKPAVVADAG AGGGNWNPRL  60
WDWDSRSLTA RPSPDALRLG SGAGQSQQQP PPPAARAAEA SRQGSGALNF QLGLREDGAT  120
AMDTTGPATV ASSPSPPRST AAGQEPVVRP SKRVRSGSPG SAGGSGGGGA ANGGGSYPMC  180
QVDDCRADLT SAKDYHRRHK VCETHSKTTK ALVANQMQRF CQQCSRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-23175227153squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973899.16e-85squamosa promoter-binding-like protein 15
RefseqXP_012702492.16e-85squamosa promoter-binding-like protein 15
SwissprotA2YX041e-69SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M81e-69SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLK3YFY31e-83K3YFY3_SETIT; Uncharacterized protein
STRINGSi013151m2e-84(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853