PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01401.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 773aa    MW: 82118.8 Da    PI: 10.3266
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01401.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.8e-40296372177
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                   +CqvegC++ l+ akeyhrrhkvCe+hskap v+v g eqrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk++
  Zmw_sc01401.1.g00130.1.am.mk 296 RCQVEGCHVLLAGAKEYHRRHKVCEAHSKAPRVVVLGAEQRFCQQCSRFHALSEFDDAKRSCRRRLAGHNERRRKSS 372
                                   6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-33290358IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.505294371IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.15E-37295374IPR004333Transcription factor, SBP-box
PfamPF031101.4E-31297370IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MYSVRSTVHG RRVHVLYSTQ HQLQRQRQRT AGNCAGSSQN RGLRTAYPLL PNAQHGDPIS  60
PKARTYSPFP SQSDMGRAVA DTDDWTGPYA LRQARTLRPC TPGLLPRAGF PASGSSVPCV  120
MTGGSESRQT VALLLSGGLA RLPACLPACF LCGEPRRVNL PPYLQQQHQT PPLFRLCLPR  180
RRQEAMEGNG GGSGTATPSW DLGMHWAPAG SSGYPQPFAP QLGGGPSRDQ QQHQQEQTWL  240
NLGKQPCCWA GAGGSQQAPQ LSSWGHVHGN GGGTGGGSGA AAAAEGKRKE KAAAPRCQVE  300
GCHVLLAGAK EYHRRHKVCE AHSKAPRVVV LGAEQRFCQQ CSRFHALSEF DDAKRSCRRR  360
LAGHNERRRK SSASETMART VGHPHGLMPF GHGFFPSSPA GALSLLSSAR GGGAPWLIPA  420
TADISARSSA ALDELIAENR RALLAWQFFS DRSPAGRLVP SSSTGRVLPA GEVPAGWHTA  480
QIQDHPGGSG GRADDRYSFS EAPAGAGHTT LDLMQTPDTS AGAPFLQPVS ERAGNARTPR  540
KDGSDAGCTS VDAWASAEGA PDRVHRCPPR PARAESQNRS GSSSVVSLNH PLQSRRRRGR  600
RPSQTNSGAR LITVPTCRSE LWDGGASYVS PRSAMMAIMA SPMRGSAIGF GKCGPYVVCK  660
ESHKRETTYA AMASPSAFRF DPAAEVTDES RQNTTTRRQA WAAAARGYGG WSYGGATWYG  720
SPYGAGGDAI FTSDQGGRKP SSDPLPLLWA AMGQFSSRAA EAAARVPVEP GRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-292973701184squamosa promoter binding protein-like 4
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439