PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01388.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 493aa    MW: 54392.6 Da    PI: 4.1579
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01388.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.5e-53241521129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknra 77 
                                     l+pGfrFhPtdeelv++yLk+kv g++l++ ++i+evd+yk+ePwdLp+  ++++++++wyfFs+ d+k+a+  r+nra
  Zmw_sc01388.1.g00210.1.sm.mkhc  24 LAPGFRFHPTDEELVSYYLKRKVLGRPLKV-DAIAEVDLYKIEPWDLPArsRLRSRDSQWYFFSRLDRKHANRARTNRA 101
                                     579***************************.99***************4357888999********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     t+ gyWk+tgkd+ev + + ++vg+kktLvf+ grapkg++t+Wvmheyrle
  Zmw_sc01388.1.g00210.1.sm.mkhc 102 TSGGYWKTTGKDREVRH-GLRVVGMKKTLVFHAGRAPKGQRTNWVMHEYRLE 152
                                     *****************.99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-6119169IPR003441NAC domain
PROSITE profilePS5100559.27924169IPR003441NAC domain
PfamPF023651.3E-2826151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MTLPSSSSSS APPPPAAGTE ATSLAPGFRF HPTDEELVSY YLKRKVLGRP LKVDAIAEVD  60
LYKIEPWDLP ARSRLRSRDS QWYFFSRLDR KHANRARTNR ATSGGYWKTT GKDREVRHGL  120
RVVGMKKTLV FHAGRAPKGQ RTNWVMHEYR LEGDETPQDS FVVCRIFQKA GPGPQNGAQY  180
GATFIEEEWE EDDEDVGLLP VGGDAIEDAV AEREAPVAME KGYLQMSDLI QGLGDQTGNS  240
TIDLPDSDTS NNGNHSEDVD GSSGDILNDP NLGSSFLQYD ELGEQNNSLI SSDEFLELKD  300
FADATNLEYP LGAHSTIWPS DGWTWKTPDS FDDINGANNE IPPLPGDQTF QSDELEQLLQ  360
SIQEDTHLGS NATDPPHSSI SNSVMAEDDS VMFYDMPFDS AICEEGFTQP NGIHTAPTTN  420
ISGIDMVDDG IPYYDAIDDS LFDDILGSIQ QPAGSSSHAF NGPVLVQELN TADKFLSFPQ  480
MARQRVGLWD RNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-462316914168Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025820240.10.0NAC domain-containing protein 53-like
TrEMBLA0A2S3I4R10.0A0A2S3I4R1_9POAL; Uncharacterized protein
TrEMBLA0A2T7DAU20.0A0A2T7DAU2_9POAL; Uncharacterized protein
STRINGPavir.Fa00048.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650