PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01384.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 308aa    MW: 33745.6 Da    PI: 7.2068
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01384.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.6e-11163208550
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                                   kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Zmw_sc01384.1.g00030.1.am.mk 163 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 208
                                   8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.9E-14159223IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76161217IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.9E-14163217No hitNo description
PfamPF001704.5E-10163213IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-11163217No hitNo description
CDDcd147033.39E-25164214No hitNo description
PROSITE patternPS000360166181IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MAQLPPKVPT MAPAWPEFGG AHHHHHHQHQ RSPSVGALLA AAPMPPLPPH HAQQQQQQPS  60
WVDEFLDFSA TKRGAHRRTV SDDNAGVGAH EFDRLDDDQL LSMFADDLAP PIPQTAPAQS  120
SSSPSDHNSF NDEKPEKGEK EEAQSKCKGD GAASAAPAPV DPKRVKRILA NRQSAQRSRV  180
RKLQYISELE RSVTSLQTEV SALSPRVAFL DHQRSLLTLG NSHLKQRIAV LAQDKIFKDG  240
AHHRPPVHTH QEALKKEIQR LRQIYHQQVL QNAESPTTDD PPIRSDEDVL IAASEGTAAA  300
AAAPCPPS
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by dehydration and salt stress. {ECO:0000269|PubMed:18065552}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020191576.11e-127basic leucine zipper 2-like
SwissprotQ5QNI51e-100BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLA0A3B6ATW91e-129A0A3B6ATW9_WHEAT; Uncharacterized protein
STRINGTraes_2AS_6EA1E372F.11e-129(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]