PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01371.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 444aa    MW: 49649 Da    PI: 4.1462
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01371.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.93.6e-4861331128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknra 77 
                                     lppGfrFhPtd el ++yLk+k+ gk+l + ++i+ev++yk+ PwdLp k ++++++ ew+fF++rdkky++g+r+nra
  Zmw_sc01371.1.g00100.1.am.mkhc   6 LPPGFRFHPTDVELCSYYLKRKIMGKSLIV-DAIAEVELYKFAPWDLPdKsCLRSRDLEWFFFCPRDKKYPNGSRTNRA 83 
                                     79*************************988.89**************96347777888********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     t +gyWk++gkd+ ++  +++ vg kktL+f++g+apkg +tdWvm ey++
  Zmw_sc01371.1.g00100.1.am.mkhc  84 TPNGYWKTSGKDRIIML-NSRIVGSKKTLIFHEGKAPKGDRTDWVMYEYKM 133
                                     *****************.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-603156IPR003441NAC domain
PROSITE profilePS5100555.8046156IPR003441NAC domain
PfamPF023651.6E-247132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MAQTSLPPGF RFHPTDVELC SYYLKRKIMG KSLIVDAIAE VELYKFAPWD LPDKSCLRSR  60
DLEWFFFCPR DKKYPNGSRT NRATPNGYWK TSGKDRIIML NSRIVGSKKT LIFHEGKAPK  120
GDRTDWVMYE YKMEDDSLVS AGFSKDAYVL CKIFKKSGLG PRIGEQYGAP FNEDEWENAE  180
GETSMFHLMP SSEVVNPVED SHVQQATPAG AIEEPILQHS SAACAREELS CDITAVAENM  240
TFSNAVAGSD IQDGLVSENN VSDEVNNFCD APEFDALLLE ELSQFLNDSP HENSFGGNSA  300
LPPMSEAEAH AFEVNTLDFY NELSGLCEFD DMPNNFYTGD DGTMEHTTLP VDRELSADEF  360
VELNDLLASD PSFPFELPAQ NNQYLQFPLA QYTYNGHHND ITAPPASFEP SCWLPTNSSI  420
FDMFPPANNS DFATDQATNF QTQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-51215711169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660428.10.0NAC domain-containing protein 82
SwissprotQ9FY823e-80NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A368QI290.0A0A368QI29_SETIT; Uncharacterized protein
STRINGPavir.J02083.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47313664
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]