PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01297.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 435aa    MW: 47972.7 Da    PI: 5.6297
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01297.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.67.9e-35230284155
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                     k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Zmw_sc01297.1.g00210.1.am.mkhc 230 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVEGLTIYHVKSHLQKYRT 284
                                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.155227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-33228286IPR009057Homeodomain-like
SuperFamilySSF466895.38E-18229284IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-26230284IPR006447Myb domain, plants
PfamPF002495.0E-10232283IPR001005SANT/Myb domain
PfamPF143794.1E-25313360IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MKKFNLMQSQ NSRVFGAMST YLPVLPNAMK ESLPRPLNPQ YIPMSRQLPD DSIPLRHSAL  60
QSVPLHPRDG SIDSSFSSYC ASQNDSVSNH ERQSIVTSFI SQHANVEVFH PLSDNALGTQ  120
IEAAWLPSSI DVLPGYMDNV TAPDDQIQSG SSAMASDEVA NQNKWLAEIM NDDWKDILDA  180
TATDSQSKTM VQPSNSAASQ PAMNQSASCL SAEICPVAGP TNSNNSSAAK QRMRWTPELH  240
ECFVDAVNQL GGSEKATPKG VLKLMKVEGL TIYHVKSHLQ KYRTARYKPD LSEGTSEKRT  300
TTEELSLDLK TSMDLTEALR LQMEVQKRLH EQLETQRKLQ LRIEEQGKYL QMMLEKQCKS  360
TTEEVQEPSS GYEEPDLSHS AHKDSGAAVV QNKTGDMTGI AERENGGSVR RVGFDAANSR  420
LLGKDDPALC VSRVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794590.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_025794591.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
SwissprotB8ANX91e-162PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A2S3IR130.0A0A2S3IR13_9POAL; Uncharacterized protein
STRINGSi035682m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789