PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01288.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 313aa    MW: 33700.5 Da    PI: 8.4539
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01288.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22.1e-14262305548
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                                     +r+rr++kNRe+A rsRq+K+a++ eLe +v++L++ N++L+k+
  Zmw_sc01288.1.g00140.1.sm.mkhc 262 RRQRRMIKNRESAARSRQKKQAYVMELEAEVAKLKELNEELQKK 305
                                     79**************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-10258310IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806260305IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.71E-11262306No hitNo description
PfamPF001701.1E-12262305IPR004827Basic-leucine zipper domain
CDDcd147074.89E-23262306No hitNo description
Gene3DG3DSA:1.20.5.1707.0E-15262305No hitNo description
PROSITE patternPS000360265280IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MELPGGNGKR RQQRQMEEHL PPMTPLPLAR QGSVYSLTFD EFQSALGGPN NDFGSMNMDE  60
LLRSIWTAEE SQAVGAANAS AAADQAAAIQ RQGSLTLPRT LSQKTVDEVW RNIMCVGGPS  120
DAPTAAAPNP PTQRQQTLGE ITLEEFLVRA GVVREDMTAG PPALPVQAPP PPPPPTSQPQ  180
MLFPQGNVFA PLVPPLPLGN GLVAGGGGTA PAVPPVQLVT SNGFGKMEGD DLSSLSPSPV  240
PYVFNGGLRG RKPSAIEKVV ERRQRRMIKN RESAARSRQK KQAYVMELEA EVAKLKELNE  300
ELQKKQMFIV PNF
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates abscisic acid (ABA) signaling (PubMed:18931143, PubMed:19947981, PubMed:27424498, PubMed:27325665). Can regulate the expression of a wide spectrum of stress-related genes in response to abiotic stresses through an ABA-dependent regulation pathway. Confers ABA-dependent drought and salinity tolerance (PubMed:18931143, PubMed:27325665). Binds specifically to the ABA-responsive elements (ABRE) in the promoter of target genes to mediate stress-responsive ABA signaling (PubMed:27325665, PubMed:27424498). {ECO:0000269|PubMed:18931143, ECO:0000269|PubMed:19947981, ECO:0000269|PubMed:27325665, ECO:0000269|PubMed:27424498}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) (PubMed:18315698, PubMed:18931143). Induced by drought, salt and osmotic stresses (PubMed:18931143). {ECO:0000269|PubMed:18315698, ECO:0000269|PubMed:18931143}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954029.11e-140bZIP transcription factor 23
SwissprotQ6Z3121e-126BZP23_ORYSJ; bZIP transcription factor 23
TrEMBLK3YTM21e-139K3YTM2_SETIT; Uncharacterized protein
STRINGSi017618m1e-140(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Xiang Y,Tang N,Du H,Ye H,Xiong L
    Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice.
    Plant Physiol., 2008. 148(4): p. 1938-52
    [PMID:18931143]
  3. Shen J,Xie K,Xiong L
    Global expression profiling of rice microRNAs by one-tube stem-loop reverse transcription quantitative PCR revealed important roles of microRNAs in abiotic stress responses.
    Mol. Genet. Genomics, 2010. 284(6): p. 477-88
    [PMID:20941508]
  4. Luo C,Guo C,Wang W,Wang L,Chen L
    Overexpression of a new stress-repressive gene OsDSR2 encoding a protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice.
    Plant Cell Rep., 2014. 33(2): p. 323-36
    [PMID:24247850]
  5. Sakuraba Y, et al.
    Rice ONAC106 Inhibits Leaf Senescence and Increases Salt Tolerance and Tiller Angle.
    Plant Cell Physiol., 2015. 56(12): p. 2325-39
    [PMID:26443376]
  6. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]
  7. Dey A,Samanta MK,Gayen S,Sen SK,Maiti MK
    Enhanced Gene Expression Rather than Natural Polymorphism in Coding Sequence of the OsbZIP23 Determines Drought Tolerance and Yield Improvement in Rice Genotypes.
    PLoS ONE, 2016. 11(3): p. e0150763
    [PMID:26959651]
  8. Zong W, et al.
    Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes.
    Plant Physiol., 2016. 171(4): p. 2810-25
    [PMID:27325665]
  9. Dey A,Samanta MK,Gayen S,Maiti MK
    The sucrose non-fermenting 1-related kinase 2 gene SAPK9 improves drought tolerance and grain yield in rice by modulating cellular osmotic potential, stomatal closure and stress-responsive gene expression.
    BMC Plant Biol., 2016. 16(1): p. 158
    [PMID:27411911]
  10. Gui J, et al.
    OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.
    Dev. Cell, 2016. 38(2): p. 201-13
    [PMID:27424498]