PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01283.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 172aa    MW: 18785.3 Da    PI: 8.2308
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01283.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM33.51.3e-103682149
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                                  lppGf+F P+de+lv ++L++k+++ +++  ++i++v +++++Pw+L++
  Zmw_sc01283.1.g00080.1.am.mk 36 LPPGFHFFPSDEDLVIHFLRRKAANVPCRP-DIIPTV-LHRYDPWELNA 82
                                  79*************************999.778876.99*******83 PP

2NAM45.22.9e-148313674128
                           NAM  74 knratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   + r+  sg W+  g d++v++ +g  vglkkt++f +g+  kg kt+Wvmhey+l
  Zmw_sc01283.1.g00080.1.am.mk  83 QGRTSPSGCWNPIGADETVTC-SGCSVGLKKTFIFCTGEPFKGFKTNWVMHEYHL 136
                                   568889***************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-3431143IPR003441NAC domain
PROSITE profilePS5100513.36736166IPR003441NAC domain
PfamPF023656.9E-1637136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MRKANPKGGG WLGLETGWGS DEGRADHIRM GGATNLPPGF HFFPSDEDLV IHFLRRKAAN  60
VPCRPDIIPT VLHRYDPWEL NAQGRTSPSG CWNPIGADET VTCSGCSVGL KKTFIFCTGE  120
PFKGFKTNWV MHEYHLLDGG GYNASGGSTS GVQQLGDMPS LRIKLRRASE LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-223514519154NAC domain-containing protein 19
3swm_B3e-223514519154NAC domain-containing protein 19
3swm_C3e-223514519154NAC domain-containing protein 19
3swm_D3e-223514519154NAC domain-containing protein 19
3swp_A3e-223514519154NAC domain-containing protein 19
3swp_B3e-223514519154NAC domain-containing protein 19
3swp_C3e-223514519154NAC domain-containing protein 19
3swp_D3e-223514519154NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021314570.15e-65NAC domain-containing protein 104 isoform X2
TrEMBLA0A0A9FYS53e-64A0A0A9FYS5_ARUDO; Uncharacterized protein
STRINGSi018368m8e-63(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679