PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01281.1.g00240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 412aa    MW: 45149.4 Da    PI: 6.9911
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01281.1.g00240.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.23.9e-54171431128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdee+v++yL +k+ +  +++  vi++vd++k+ePw+Lp k+k +ekewyfF+++d+ky+tg+r+nrat+sg
  Zmw_sc01281.1.g00240.1.am.mk  17 LPPGFRFHPTDEEVVSHYLIPKALSCLFTC-LVIADVDLNKCEPWELPGKAKMGEKEWYFFCHKDRKYPTGTRTNRATASG 96 
                                   79************************9999.78***************99999**************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkdke+++ +g lvg+kktLvfy grap+g+kt Wvmheyr+
  Zmw_sc01281.1.g00240.1.am.mk  97 YWKATGKDKEIFRGRGVLVGMKKTLVFYLGRAPHGKKTPWVMHEYRI 143
                                   *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-606153IPR003441NAC domain
PROSITE profilePS5100554.45317203IPR003441NAC domain
PfamPF023656.3E-2818143IPR003441NAC domain
SuperFamilySSF1019411.02E-60191203IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MSEVSEMHNQ GEEQLELPPG FRFHPTDEEV VSHYLIPKAL SCLFTCLVIA DVDLNKCEPW  60
ELPGKAKMGE KEWYFFCHKD RKYPTGTRTN RATASGYWKA TGKDKEIFRG RGVLVGMKKT  120
LVFYLGRAPH GKKTPWVMHE YRIEGRLPPN LPRAAKGRMS CRPPSCRRAW TTRGRKRALT  180
SSLVFFSTCC VQDEWAVCRV FNKEYLAAKP GLQQTASTSS PAAAGTMQRS DSLAFLDDLL  240
DPADLPPLTD SPFADDFKGA AVPGSMSNMI SGCQQVKTEQ PAPAQNPPPP PALMQDTAYS  300
YFSLPATNNN TGGYSHHPQA AGADHLSAIR RHCTATAPAL ASPDIARTPL YPELESLDDL  360
GGLMDYSNMW NVGEIGSGSP GDEAMDRVCW CAGTASVDPV VVGVCCLQII LE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-501414317145NAC domain-containing protein 19
3swm_B6e-501414317145NAC domain-containing protein 19
3swm_C6e-501414317145NAC domain-containing protein 19
3swm_D6e-501414317145NAC domain-containing protein 19
3swp_A6e-501414317145NAC domain-containing protein 19
3swp_B6e-501414317145NAC domain-containing protein 19
3swp_C6e-501414317145NAC domain-containing protein 19
3swp_D6e-501414317145NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461233.11e-113NAC domain-containing protein 79
SwissprotQ9FK444e-80NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0A9IAM41e-127A0A0A9IAM4_ARUDO; Uncharacterized protein
STRINGSb02g043270.11e-112(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]