PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01274.1.g00190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 470aa    MW: 49649.8 Da    PI: 9.4232
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01274.1.g00190.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA30.84e-10331352122
                          GATA   1 CsnCgttkTplWRrgpdgnktL 22 
                                   Cs+Cg+ kTp+WR gp+g ktL
  Zmw_sc01274.1.g00190.1.sm.mk 331 CSHCGVQKTPQWRAGPEGAKTL 352
                                   *******************998 PP

2GATA59.93.2e-19390424135
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                   Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Zmw_sc01274.1.g00190.1.sm.mk 390 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 424
                                   *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.4E-4325371IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-6329352IPR013088Zinc finger, NHR/GATA-type
PfamPF003207.2E-8331352IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.11384420IPR000679Zinc finger, GATA-type
SMARTSM004013.4E-18384438IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.04E-14387447No hitNo description
Gene3DG3DSA:3.30.50.102.4E-15388422IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.54E-14389446No hitNo description
PROSITE patternPS003440390415IPR000679Zinc finger, GATA-type
PfamPF003203.4E-17390424IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MDAMKSNAFP PEDAAEEAAN AAALGERDGF SVEDLLDLEE FGEPDKDETD HQDAAPPLAA  60
DETEENSPGD DSQPSSMVTF ELPPPPPEMV DLPFDGPSYV RKGGGFRESS VVGSASSGKK  120
AFNIRSGVLQ AHDVEEELEW VSRIMDDSLS EVPPPPQPRA VAGAAVQAAR PPLAQRMPYD  180
SAYRALPPAP PGPPRAPTVC ALSTEALVPV KAKRSKRSRS SAWSMSGASL FSDSASSSST  240
ATTSSCSSSS ASFSPFFLLD SPPPFGFPDF EGFPHFLPPP VQARKSSRHG KGSKHKPKKR  300
GRKPKHAPQL TGAAAASAAA ASLVAQGERR CSHCGVQKTP QWRAGPEGAK TLKHKPKKRG  360
RKPKHAPQLT GAAAASAAAA SLVAQGERRC SHCGVQKTPQ WRAGPEGAKT LCNACGVRYK  420
SGRLLPEYRP ACSPTFVSSI HSNSHRKVLE MRRKKEAGLL GTAAPAVASF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151060.11e-112GATA zinc finger family protein
TrEMBLA0A0A9D1L51e-117A0A0A9D1L5_ARUDO; Uncharacterized protein
STRINGGRMZM2G404973_P031e-107(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108