PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01257.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 1120aa    MW: 118706 Da    PI: 11.6125
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01257.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.41.6e-41831906176
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                                     +CqvegC +dls ak y+ rhkvC +h+k+pvv+v+g+eqrfCqqCsrfh+l efD++krsCrrrLa+hnerrr++
  Zmw_sc01257.1.g00130.1.am.mkhc 831 RCQVEGCGVDLSGAKPYYCRHKVCCIHAKTPVVVVAGIEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRRP 906
                                     6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.9E-33827893IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18829906IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-39830909IPR004333Transcription factor, SBP-box
PfamPF031102.2E-31832905IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1120 aa     Download sequence    Send to blast
MLRRRRTPMP AAGSGDDETG IPPAYKRRGR PQRHFKTDTD EEVDDSIRTE AAGDSDGAKP  60
STPSNDGASV QNAGTAKKRR RRQPKRGLDS AAEEKDDEPV RQVGFRRHGS RRKSTQRRAA  120
EAGVECSTST FGSVVQARVV PLATRRRAGG ITSLGDAARN HVREITVETR KPKLKNGRHP  180
IGRGGKERKR LLLIRAAHAL FPVRAETAPG QSPRAEPVSF LPEPAVLGTG TSKRSSRDGP  240
SPPTPSARAS GIACGTFGAG SSLLHVSQAC KPATVARARW LPPACRPNSH AHSHRRTVKH  300
ALGSCSGRGP VEAHGRQRPS RSMHARTAAA GRPVRRRVSD SAGAGRPAPL ASCSRRRLSP  360
PRATVAERSG ACRGSHPLRP LRGRSVSVAE GLMGQARGWT HARGSGGDDV TGDWKGTPQL  420
AETRRGCLLA RDDGTPAPQT EVPRRAVVRT VIIHVLEPDP ARRRLVELKV EARGQGRPSH  480
PCLPTKPSVL LGLAEDTANF TVHRLPAPPP PPTITSAPHS RSCERWQLAT ASELSLDVTP  540
ANSHARTSAP VIQLACAFSR RTDGFERRLR YWFLDQASRG GRCGRSNGAK EGPYRQPRCG  600
KPTQGHRRCR GAVRAQWPLP PLFTSLARAV ARPPVAGRLA FLSLSPVRVT VDYTGASPVR  660
AHEGIAVATV RRVKTAREVH KARLPTKPQC PRNTIAKERV GAASGSSRGA RKESLLVVVE  720
ASSGTKRGQR GRAGKIATTL PQQGSEARQL AAMDTGGSGG GGGDDVHGLK FGKKIYFEQD  780
STAGGSREAA GGGRKGKSAA AGSSGGAAST APTAAGAVAA ATPPRAATPP RCQVEGCGVD  840
LSGAKPYYCR HKVCCIHAKT PVVVVAGIEQ RFCQQCSRFH QLPEFDQGKR SCRRRLAGHN  900
ERRRRPPPGP LNSRFGRLAS SFQGVQPGDR MSSAIQWQGN HDQLRPRSGV VAGYGDHAYI  960
GPGGSVAGTS SMHPAFELPH GGCVAGVATD SCCALSLLST QPWDSIQSGS HHHRSPAMST  1020
ASAFEGSNPV PVSPSVMASS YAAASTWSGS RVHESARNLH HHHPSSQEGD LHMVHPGSVH  1080
HGHFSGELEL ALQGSGEPSN PPQVDHGSSG AFGHSSNAVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-288329051184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17681KKRRRR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787