PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01251.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 416aa    MW: 45070.9 Da    PI: 8.9323
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01251.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1609.6e-50401652128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++PwdLp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgy
  Zmw_sc01251.1.g00060.1.sm.mk  40 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWDLPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGY 119
                                   79***************************.89***************8778899*************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ + +++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Zmw_sc01251.1.g00060.1.sm.mk 120 WKATGADRMIRAENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 165
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-5439201IPR003441NAC domain
PROSITE profilePS5100554.12939202IPR003441NAC domain
PfamPF023651.3E-2441165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MSSGRLENGH SAAAPAVEGG GGGGRGGEGG GDSHEDDLVM PGFRFHPTEE ELIEFYLRRK  60
VEGKRFNVEL ITFLDLYRYD PWDLPALAAI GEKEWFFYVP RDRKYRNGDR PNRVTASGYW  120
KATGADRMIR AENNRPIGLK KTLVFYSGKA PKGVRSSWIM NEYRLPPDDT DRYNKLPHGR  180
ISLCSEQFVI RTEISLCRVY KRSGIDDGHG SRPSSARSTP SSGATAQRDT NKQAASSSST  240
PTPTPPATPS KLHLLHGECT SPLAIADHAR GHKAPSAPRQ QKPSSAYLSA TSASADGDHQ  300
HEGTAATPYE HPRNTNPFAS TYSLLSLVNA AAMGTSSAAA IDELSTVVGH GSPSTAYFNH  360
HQQAGGHSHF LSLPTAPPSS QPALSVSLQA AISDKIWEWN TIPDAAGRDY SSARFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-514120319166NO APICAL MERISTEM PROTEIN
1ut4_B2e-514120319166NO APICAL MERISTEM PROTEIN
1ut7_A2e-514120319166NO APICAL MERISTEM PROTEIN
1ut7_B2e-514120319166NO APICAL MERISTEM PROTEIN
4dul_A2e-514120319166NAC domain-containing protein 19
4dul_B2e-514120319166NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12230GGRGGEGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970843.11e-170NAC domain-containing protein 35
TrEMBLA0A1E5WH591e-172A0A1E5WH59_9POAL; NAC domain-containing protein 35
STRINGSi001651m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787