PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01236.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 458aa    MW: 50509.4 Da    PI: 10.0904
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01236.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.74e-52221511128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhP+dee++++yL++kv ++++++ ++i e+di+k+ePw+Lp+k+k +ekewyf+s +  ky++g+r+nratk+g
  Zmw_sc01236.1.g00050.1.sm.mk  22 LPPGFRFHPSDEEIITFYLRPKVINNRFTA-HAIGEADINKCEPWELPEKAKMREKEWYFYSLKGLKYPSGSRANRATKAG 101
                                   79*************************999.88***************99999**************************** PP

                           NAM  82 yWkatgkdkevlskkgel...vglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+e++++++++   vg+kktLvfykgrap+g ktdWvmhe+rl
  Zmw_sc01236.1.g00050.1.sm.mk 102 YWKATGKDREIYQATSKKpvlVGMKKTLVFYKGRAPTGDKTDWVMHEFRL 151
                                   *************85554566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-5917188IPR003441NAC domain
PROSITE profilePS5100556.34422188IPR003441NAC domain
PfamPF023651.0E-2523151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MADHHQQQWR TSDDTNSGRL KLPPGFRFHP SDEEIITFYL RPKVINNRFT AHAIGEADIN  60
KCEPWELPEK AKMREKEWYF YSLKGLKYPS GSRANRATKA GYWKATGKDR EIYQATSKKP  120
VLVGMKKTLV FYKGRAPTGD KTDWVMHEFR LDGSGKLPHP AASSSSSTSM VMKSSSQEEW  180
VICRIYLKSS SVKKAPTPSV DIASMVGDVE QRSMSFPLPM QFPMGPGDFA GGSNTLRHIM  240
DPSPFFYSAT AISTTISPTI LPMADMGSYD LPMDTTHFQD PIAPAQPILY NQTGIGPVED  300
GRLMGRLDSG STSIVLRDPR MSAQQTNVDI SGEVLARKTG SLIAADPEPV IAYAVAEMRS  360
ARHHGRTKGR TEQKDPFAPP NRRAAGRQPR SSALLRRLDL QPSVSQQPDT AGVHAYLAAA  420
YVASSRSAVP APLSRDGYRA ACCRIRSYRA GRQALGPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-451919414171NO APICAL MERISTEM PROTEIN
1ut4_B1e-451919414171NO APICAL MERISTEM PROTEIN
1ut7_A1e-451919414171NO APICAL MERISTEM PROTEIN
1ut7_B1e-451919414171NO APICAL MERISTEM PROTEIN
3swm_A1e-451919417174NAC domain-containing protein 19
3swm_B1e-451919417174NAC domain-containing protein 19
3swm_C1e-451919417174NAC domain-containing protein 19
3swm_D1e-451919417174NAC domain-containing protein 19
3swp_A1e-451919417174NAC domain-containing protein 19
3swp_B1e-451919417174NAC domain-containing protein 19
3swp_C1e-451919417174NAC domain-containing protein 19
3swp_D1e-451919417174NAC domain-containing protein 19
4dul_A1e-451919414171NAC domain-containing protein 19
4dul_B1e-451919414171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022679478.11e-101protein CUP-SHAPED COTYLEDON 1
TrEMBLK3ZUK31e-102K3ZUK3_SETIT; Uncharacterized protein
STRINGSi030284m1e-102(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121