PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01225.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 347aa    MW: 37554.9 Da    PI: 8.9548
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01225.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1623.1e-50992541136
                           TCP   1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81 
                                   aa +kdrhski+T++g+RdRR+Rls ++a++fF+Lqd+LGfdk+skt++WLl+ +k+ai+e++ +  +++sec ++sss s
  Zmw_sc01225.1.g00080.1.am.mk  99 AASRKDRHSKICTAGGMRDRRMRLSFDIARKFFALQDMLGFDKASKTVQWLLNTSKAAIQEIMTD--DASSECVDGSSSLS 177
                                   588**************************************************************..66666966666666 PP

                           TCP  82 as...nsssg......................kaaksaakskksqksaasalnlakesrakarararertrekmriknkl 136
                                   ++   n                          ka+++++++k+++ksa+++  l+ke+rakar+rarertrek+r+++++
  Zmw_sc01225.1.g00080.1.am.mk 178 VDgkhN---LteelggdqqkkgngcsegkksaKARRETTTPKPPRKSANAHPVLDKETRAKARERARERTREKHRMRWVK 254
                                   663330...235566666667789999999978888888**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.1E-44101250IPR005333Transcription factor, TCP
PROSITE profilePS5136934.558102160IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.54230247IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MPLYQQLQLS SPSPKPDQSS SSFYYYPCSP PFAAAADASS FDMSYQLDSA AATTPAPAVV  60
NSPELPMRPS MEQPPAPKHG PGNAQGAGGA SLDTAYPAAA SRKDRHSKIC TAGGMRDRRM  120
RLSFDIARKF FALQDMLGFD KASKTVQWLL NTSKAAIQEI MTDDASSECV DGSSSLSVDG  180
KHNLTEELGG DQQKKGNGCS EGKKSAKARR ETTTPKPPRK SANAHPVLDK ETRAKARERA  240
RERTREKHRM RWVKLASAID VEAAAGRDQP NASNLNHSPS MNMASAAELG ERCSSTLNHG  300
GRTQEVSMPS EPNDMILAFG NGAYGGRNYC QEQWELGGVV FANSRFY
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Involved in apical dominance. Represses the growth of axillary organs (e.g. lateral branches), but enables the formation of female inflorescences. Regulates the number and length of axillary branches. {ECO:0000269|PubMed:12524360, ECO:0000269|PubMed:16642024, ECO:0000269|PubMed:17947410, ECO:0000269|PubMed:8536981, ECO:0000269|PubMed:9087405}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796975.11e-150transcription factor TEOSINTE BRANCHED 1-like
SwissprotQ93WI21e-129TB1_MAIZE; Transcription factor TEOSINTE BRANCHED 1
TrEMBLA0A346M1071e-177A0A346M107_CYNDA; Teosinte branched 1
STRINGPavir.Ia00838.1.p1e-152(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP72533651
Publications ? help Back to Top
  1. Tenaillon MI, et al.
    Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. mays L.).
    Proc. Natl. Acad. Sci. U.S.A., 2001. 98(16): p. 9161-6
    [PMID:11470895]
  2. Clark RM,Tavaré S,Doebley J
    Estimating a nucleotide substitution rate for maize from polymorphism at a major domestication locus.
    Mol. Biol. Evol., 2005. 22(11): p. 2304-12
    [PMID:16079248]