PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01217.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 347aa    MW: 38047.4 Da    PI: 11.7804
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01217.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.76.8e-15190250363
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   ++k  +r+ +NR++A+  R+R+ka+++ Le kvk Le++N+++ ++l++l++e + l+++v
  Zmw_sc01217.1.g00200.1.am.mk 190 ADKEHKRLKRNRVSAQQARERRKAYLADLEVKVKDLEKKNSEMEEKLSTLQNENQMLRQDV 250
                                   7899***************************************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-12188252IPR004827Basic-leucine zipper domain
PfamPF001704.2E-13190250IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.656190253IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.75E-11192248No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-14192250No hitNo description
CDDcd147041.47E-16195244No hitNo description
PROSITE patternPS000360195210IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
LSVSAAGARG PERVHVPQHR ALGWRPRTGG LRGGHDGGFP AVDLRRLDGW AVAAKTPNPQ  60
LRVGAINAVA AIWFTVEAPS MFRNSRADPM AFVPASHVKY RRMQEQAASS LPSSSERSSS  120
SAHHMEMDLK EGKRLRMESD EEIRRVPELG LELPSGPSTS GREAGGAERA QASSAAAAQS  180
GGRRRLRTPA DKEHKRLKRN RVSAQQARER RKAYLADLEV KVKDLEKKNS EMEEKLSTLQ  240
NENQMLRQDV QLIHHRPRFV LDVSGARPRI DLPTLGAVGG RSCRLTRPPP PVSFPLVLIP  300
SDSKTVTSRG RTVFWRAASL ACVRSVARRS LLSARAASGC TIPRLSL
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111