PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01162.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 394aa    MW: 43162.6 Da    PI: 10.3759
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01162.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-432103091100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +Ca+Ck+lrr+C+kdC++ap fpa++p+kfa+vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+
  Zmw_sc01162.1.g00020.1.am.mk 210 PCASCKLLRRRCTKDCIFAPFFPADDPHKFAIVHKVFGASNISKMLQELPVQQRGDAVSSLVYEANARVRDPVYGCVGAIS 290
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq+q++ql+ +la++++e
  Zmw_sc01162.1.g00020.1.am.mk 291 FLQNQVSQLQMQLAVAQAE 309
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.483209310IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-43210307IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MCPDLPVLLG RALARVKHAY YMGTVDCRRR HASILSCPVI ITLPQIVITR ATDKLSARGR  60
EGGGLHEQYN ASIDRRTDTA RIFLRSVDRR SATGRGGGLH TYCGLQWSAL MFVPSKIQHG  120
TLQLADRVRS IDRRTRVNRS SRASHAAHAG MRRRLKSDRG LIGLSWTLSR FPRLVNGDFP  180
IDASLRGYIS GTWPPAVEKS NEQRMAGGSP CASCKLLRRR CTKDCIFAPF FPADDPHKFA  240
IVHKVFGASN ISKMLQELPV QQRGDAVSSL VYEANARVRD PVYGCVGAIS FLQNQVSQLQ  300
MQLAVAQAEI LCIQMQRRDD DGHHGSDGAA AAGVPPALVA AGDHHHVIPS QHQATPSMMA  360
PVDVDAFLMH NVGGVPPQMM AGAGEKLKRE SLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-432063117112LOB family transfactor Ramosa2.1
5ly0_B2e-432063117112LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150