PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01156.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 547aa    MW: 57075.7 Da    PI: 10.1255
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01156.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.82.6e-42238313176
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                                   +CqvegC++dl+  k+y+ rhkvC++h+k+p v+v+g+eqrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk+
  Zmw_sc01156.1.g00050.1.am.mk 238 RCQVEGCDVDLTGSKTYYYRHKVCSAHAKTPLVIVAGIEQRFCQQCSRFHQLSEFDQGKRSCRRRLAGHNERRRKP 313
                                   6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-33231300IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.915236313IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.06E-40237316IPR004333Transcription factor, SBP-box
PfamPF031108.1E-33239312IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MACYVALRFL LVPLAGQRNA GTVPLAATNT AFSLQGYGVR KPHYKNPGSA RLGTPLLTRE  60
ASATATAFLP SIASAQPIEM ASAKGGGRDK LGQLVCARSR RVILSAKPPR SCPSASPPPS  120
LSSLPEREKR GAENLLPPLQ SSSPRAFPAH RRTIMATASA GAGGGSGGGG GDDQLHGLKF  180
GKKIFFEDAG STSGDGSSSG SGSGSAPPPP ASPRATGGGR RGTGAAGGAS SSSAQPARCQ  240
VEGCDVDLTG SKTYYYRHKV CSAHAKTPLV IVAGIEQRFC QQCSRFHQLS EFDQGKRSCR  300
RRLAGHNERR RKPPPGPLAS RYGRVAASFG EEPSRFRSFM LDFSYPRVPS SMRDGWPAAR  360
PGERVPGSIQ WQANLDPHHH HSAVAGYGLH PYGSQRSSAP RPSAFPGTEL PPGGCLAGAP  420
ADSSCALSLL STQPWDTTHS ASHDRAATLS STGGFGGNPV TPSLMASNYI TPSPWTGPPG  480
HEGGQSVPPQ LPPEVPLDEV PSGPSHHGQF SGELELALQG NRPAPRRMDH GSSSTFNQDS  540
NPTDWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-302393121184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974838.11e-173squamosa promoter-binding-like protein 14 isoform X1
SwissprotQ7EXZ21e-138SPL14_ORYSJ; Squamosa promoter-binding-like protein 14
TrEMBLA0A3Q8AS141e-177A0A3Q8AS14_9POAL; Squamosa-promoter binding protein-like protein
STRINGSi013870m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Miura K, et al.
    OsSPL14 promotes panicle branching and higher grain productivity in rice.
    Nat. Genet., 2010. 42(6): p. 545-9
    [PMID:20495564]
  3. Jiao Y, et al.
    Regulation of OsSPL14 by OsmiR156 defines ideal plant architecture in rice.
    Nat. Genet., 2010. 42(6): p. 541-4
    [PMID:20495565]
  4. Springer N
    Shaping a better rice plant.
    Nat. Genet., 2010. 42(6): p. 475-6
    [PMID:20502488]
  5. Wang Y,Li J
    Branching in rice.
    Curr. Opin. Plant Biol., 2011. 14(1): p. 94-9
    [PMID:21144796]
  6. Wang J,Kong L,Gao G,Luo J
    A brief introduction to web-based genome browsers.
    Brief. Bioinformatics, 2013. 14(2): p. 131-43
    [PMID:22764121]
  7. Luo L,Li W,Miura K,Ashikari M,Kyozuka J
    Control of tiller growth of rice by OsSPL14 and Strigolactones, which work in two independent pathways.
    Plant Cell Physiol., 2012. 53(10): p. 1793-801
    [PMID:22960246]
  8. Liu Q, et al.
    The alteration in the architecture of a T-DNA insertion rice mutant osmtd1 is caused by up-regulation of MicroRNA156f.
    J Integr Plant Biol, 2015. 57(10): p. 819-29
    [PMID:25677853]
  9. Cruz-Garcia GS,Struik PC
    Spatial and Seasonal Diversity of Wild Food Plants in Home Gardens of Northeast Thailand1.
    Econ. Bot., 2015. 69(2): p. 99-113
    [PMID:26160981]
  10. Srikanth B, et al.
    Enhanced expression of OsSPL14 gene and its association with yield components in rice (Oryza sativa) under low nitrogen conditions.
    Gene, 2016. 576(1 Pt 3): p. 441-50
    [PMID:26519999]
  11. Perignon M, et al.
    Impact of Multi-Micronutrient Fortified Rice on Hemoglobin, Iron and Vitamin A Status of Cambodian Schoolchildren: a Double-Blind Cluster-Randomized Controlled Trial.
    Nutrients, 2016.
    [PMID:26751473]
  12. Kim SR, et al.
    Development and validation of allele-specific SNP/indel markers for eight yield-enhancing genes using whole-genome sequencing strategy to increase yield potential of rice, Oryza sativa L.
    Rice (N Y), 2016. 9(1): p. 12
    [PMID:26987543]