PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01152.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 335aa    MW: 36439.8 Da    PI: 5.2567
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01152.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.95.7e-5191331128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeelv++yL++k++g +l +  vi+evd+y+++Pw+Lp+k+ ++ekewyfFs+rd+ky++g+r+nra+ 
  Zmw_sc01152.1.g00130.1.am.mkhc   9 LPPGFRFHPTDEELVNYYLCRKCTGLPLAA-PVIAEVDLYRFDPWQLPEKAMGGEKEWYFFSPRDRKYPNGSRPNRAAG 86 
                                     79*************************999.89***************8888999************************ PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +gyWkatg dk+v s   + v +kk Lvfy g+ pkg+kt+W+mheyrl
  Zmw_sc01152.1.g00130.1.am.mkhc  87 TGYWKATGADKPVGS--PRPVAIKKALVFYAGKPPKGVKTNWIMHEYRL 133
                                     *************99..779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-616163IPR003441NAC domain
PROSITE profilePS5100559.3519163IPR003441NAC domain
PfamPF023652.5E-2610133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MDCGGALQLP PGFRFHPTDE ELVNYYLCRK CTGLPLAAPV IAEVDLYRFD PWQLPEKAMG  60
GEKEWYFFSP RDRKYPNGSR PNRAAGTGYW KATGADKPVG SPRPVAIKKA LVFYAGKPPK  120
GVKTNWIMHE YRLADVDRSA AARKRTSNAL RLDDWVLCRI YNKKGVIERY DTVDEDAVAL  180
GGDVKPASAA PAKNARGRAA AAAPMKVEMD DYAAYYDSYD LESPPAAEML CFDRPFQSAP  240
SSEPSADHGS DSAPRLHTDN SSSGSEHVLS PSPDLPDHAE SQPGAGWFDG VVDWGGGGVD  300
DGFDALFALP SPVGFPGARD AVAIGEMFAY LQRPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-7621698174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses. {ECO:0000269|PubMed:20632034}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by dehydration, salt stress, cold stress, abscisic acid (ABA) and methyl jasmonate. {ECO:0000269|PubMed:20632034}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978885.11e-146NAC domain-containing protein 71
SwissprotQ53NF71e-147NAC71_ORYSJ; NAC domain-containing protein 71
TrEMBLA0A3L6Q3571e-149A0A3L6Q357_PANMI; NAC domain-containing protein 71-like
STRINGPavir.Ha00897.1.p1e-153(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118043039
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sperotto RA, et al.
    Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains.
    J. Plant Physiol., 2010. 167(17): p. 1500-6
    [PMID:20580124]
  3. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  4. Kan CC,Chung TY,Juo YA,Hsieh MH
    Glutamine rapidly induces the expression of key transcription factor genes involved in nitrogen and stress responses in rice roots.
    BMC Genomics, 2015. 16(1): p. 731
    [PMID:26407850]