PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01150.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 384aa    MW: 40717 Da    PI: 5.5857
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01150.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.14.5e-14275326556
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                                     +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N +L k+ ee+ ++ 
  Zmw_sc01150.1.g00040.1.sm.mkhc 275 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKELNAELMKKQEEMMEMQ 326
                                     79****************************************9999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.9E-12271336IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806273324IPR004827Basic-leucine zipper domain
CDDcd147075.76E-28275329No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-14275325No hitNo description
PfamPF001701.8E-12275327IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.18E-10275324No hitNo description
PROSITE patternPS000360278293IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MDLKDGERRG PPLARQGSIY SLTFDEFQST LGGVGGGLGK DFGSMNMDEL LRSIWTAEES  60
QAMASASGAA APAVEDGALQ RQGSLTLPRT LSVKTVDEVW RDFVREGAPP DGGGGGEPQP  120
SRQPTLGEMT LEEFLVRAGV VRENPAAAAA VAAAGISAPP VAAPRPIQAV GNGSSIFFGN  180
FGGASDAGAG AMGFAPVGIG DPSTIGNGLM PGVAGMGGAP VSVSPLDTSV AQLDSVGKGN  240
SDLSSPSPMA PVPYPFDGVI RGRRSGAGVE KVVERRQRRM IKNRESAARS RARKQAYTME  300
LEAEVQKLKE LNAELMKKQE EMMEMQKNQV LETVSNPYAQ KKRCLRRTLT GPWNFNWTET  360
FIVNPEALAH GEKSAFMWHL WADN
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973666.11e-177bZIP transcription factor TRAB1
SwissprotQ6ZDF31e-149TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A2T7D8L41e-176A0A2T7D8L4_9POAL; Uncharacterized protein
STRINGGRMZM2G157722_P011e-167(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]