PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01069.1.g00280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 234aa    MW: 25381.5 Da    PI: 4.8633
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01069.1.g00280.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.12e-40541531100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll++lpe+ r da+ss+vyeAear+rdPvyG++g + 
  Zmw_sc01069.1.g00280.1.am.mk  54 PCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNMIKLLQDLPESSRADAVSSMVYEAEARLRDPVYGCAGAVC 134
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+q ++lk++la++++ 
  Zmw_sc01069.1.g00280.1.am.mk 135 RLQKQANELKVQLARAQAD 153
                                   **************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.29353154IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4054151IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MEYSNASTGM TAAEHYYRSM SPPSWESSSG SPSPSPPSAV QLVGNVAPTV VMSPCAACKI  60
LRRRCADGCV LAPYFPPTEP AKFTTAHRVF GASNMIKLLQ DLPESSRADA VSSMVYEAEA  120
RLRDPVYGCA GAVCRLQKQA NELKVQLARA QADLLNVQAQ HANLLALVCV EVANRRDSPQ  180
QEQQTTSTPL VMDDGGSCSD LGGAGYQMFY DSDLLDSATW PDHEAQLWTY EQRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-415315610113LOB family transfactor Ramosa2.1
5ly0_B2e-415315610113LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465424.11e-111LOB domain-containing protein 1
SwissprotQ9LQR02e-63LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2T7CE111e-111A0A2T7CE11_9POAL; Uncharacterized protein
STRINGPavir.Ib01336.1.p1e-112(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790