PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01052.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 329aa    MW: 35281.2 Da    PI: 10.2841
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01052.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.21.8e-27105150146
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46 
                                   k+ien +nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+l
  Zmw_sc01052.1.g00140.1.am.mk 105 KPIENATNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRL 150
                                   78******************************************98 PP

2K-box25.65.2e-102372644471
                         K-box  44 esLslkeLqqLeqqLekslkkiRskKne 71 
                                   +++sl++L++Le +Lek+++kiR++K+ 
  Zmw_sc01052.1.g00140.1.am.mk 237 QTMSLRDLKHLEGRLEKGINKIRARKMA 264
                                   58************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.46997150IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-3297156IPR002100Transcription factor, MADS-box
CDDcd002657.43E-3399150No hitNo description
PRINTSPR004041.5E-2699119IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.23E-2499151IPR002100Transcription factor, MADS-box
PfamPF003192.4E-24107150IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-26119134IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-26134155IPR002100Transcription factor, MADS-box
PfamPF014869.8E-6236265IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEMARWVEDV VVGKEERDAF ASVTLCDERR PGLSPPPPAP ISLSGSQSSP VPKQALATIS  60
TLNMMSQTDL SCGPSKVKEQ PATANSGPSS GSTKPGIIRG RIEIKPIENA TNRQVTFCKR  120
RNGLLKKAYE LSVLCDAEVA LVVFSSRGRL TMPGACVALL QGSQKPKPMA AAAAAEEKRG  180
ARIASGDDTS KENWCLGGNA KSREAPLHVG VKATIERYKK ANSDSSNTGT VAEVNAQTMS  240
LRDLKHLEGR LEKGINKIRA RKMAANERGH EQSVGIQMAA ASTSEYDPLV PSDNPPRREA  300
KQEPARVLGE AVWPSVPARL IGRRPRNQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-1499150354Myocyte-specific enhancer factor 2B
1tqe_Q2e-1499150354Myocyte-specific enhancer factor 2B
1tqe_R2e-1499150354Myocyte-specific enhancer factor 2B
1tqe_S2e-1499150354Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968558.17e-48PREDICTED: MADS-box transcription factor 3 isoform X2
SwissprotQ407042e-40MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0A9TLG61e-57A0A0A9TLG6_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3471634