PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01035.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 407aa    MW: 45067.4 Da    PI: 8.1868
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01035.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM46.21.4e-14177220650
                           NAM   6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50 
                                   +FhPtdeel+ +yLk+k+++k+l++ e i+++diyk++PwdLp++
  Zmw_sc01035.1.g00080.1.am.mk 177 QFHPTDEELIGFYLKRKIQHKSLPI-ELIRQLDIYKYDPWDLPMS 220
                                   7************************.89**************953 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-13177218IPR003441NAC domain
PfamPF023651.0E-4177215IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MIERSPHARL SIDVPKIFPP LSRLANQALP IDAMRPCTRT DRQLPRPVRV GQVLCCLRNT  60
TEVHGLCSEL SKLWSPAGMM RFDQAESETS IVFPRLASFP ADANWSAASV FPWSWSWSRC  120
PMPHVHGRNA DVRGTAHHAV SCRPHEWVWH GPIEVKQARD KPQTDIPFED GCGATRQFHP  180
TDEELIGFYL KRKIQHKSLP IELIRQLDIY KYDPWDLPMS IIDSSSSRPA ASTALPPSGA  240
DHQNMSVLSA IPLDLPAGMD ITSMVLNVTP TSLQNVSRIP TNIEFGQPQH CNSNSSSSLV  300
TRCTVDLPDV GSGINGAQRS INFPFNMQGA LPDDWRMTFP AHGPVVLQGI ASRGAANPSR  360
DLCTTTARRV FAGLAQWCEK QFLWCISPNG WSARPARAST LVSWTIG
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3306722