PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01033.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 395aa    MW: 42559.1 Da    PI: 9.6339
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01033.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer90.71.3e-28324381260
                   ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                                   ++vrY eC++NhAa++Gg++vDGC+Ef+++ geegt  alkCaACgCHR+FHRr +++e
  Zmw_sc01033.1.g00010.1.am.mk 324 CSVRYGECRRNHAATTGGYSVDGCREFIAE-GEEGTGGALKCAACGCHRSFHRRVQVYE 381
                                   789**************************8.999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-24306385IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.0E-27326378IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-20327376IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.361328377IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
AWLGALVRDS GTAMATHACY SYSSMDMHES SKASHRKKLE KKKARVKSNA TRDPGGRDGR  60
SATPCGLGNA QGPDSMPAPT QAGRPQGATA LLRAPCIMQA CRGTPNLIQS SCREEGRKEG  120
RTHAVEGRWR VPSAHLVRGL NAPALPAPSL IDLKALSPLI TAAPLRSRNG MELNGPPEAD  180
PGDGIRRRRD GETSAPPTDK RARTYCCRPA GSVRSIDRNS RGAVGVRSGT VRSILSDRME  240
VIGARYERPA VASPTRRISP VSHDDVGGGG GDSYLPVVHS KQGLHSPCAE TRLWLAGWEE  300
EGRLTMKRLL ILRRCEPIVR FTCCSVRYGE CRRNHAATTG GYSVDGCREF IAEGEEGTGG  360
ALKCAACGCH RSFHRRVQVY EVSWDYAASD SSSTE
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120