PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01019.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 469aa    MW: 49546.5 Da    PI: 10.1281
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01019.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP89.38.7e-2854124373
                           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                   g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WL+ + +++i++l+ ++++++++ 
  Zmw_sc01019.1.g00140.1.am.mk  54 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLIDATQHEIDKLPPLQFPPQHAQ 124
                                   78*************************************************************99999443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.8E-2555118IPR005333Transcription factor, TCP
PROSITE profilePS5136928.59655113IPR017887Transcription factor TCP subgroup
PfamPF036340.0013260278IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MISGNHTNEE LAGCRKAEQP AVVDAGAAKS AAASSRPWPP STESRIVRVS RVFGGKDRHS  60
KVRTVKGLRD RRVRLSVPTA IQLYDLQDRL GLSQPSKVVD WLIDATQHEI DKLPPLQFPP  120
QHAQDLVAHL QPTSMLTPFA SAAAEATAAS SVLDGDKGGI KGLMGLNNSV SLGNGAMPLS  180
HGLHFAGESW TNGGSVHDQV SHGNSPQPTV AHHSPFSSLL SLAPGPQLVF YSPEGGGFTM  240
KEASDQFPSR IVRVSRVFGG KDRHSKVRTV KGLRDRRCGC PCRLRSSSTT SRTGWGSVSL  300
ASTRSTSCRR CSSRRKHAQD LVAHLQPTSM LTPFASAAAA ATAASSVLDG DKGGIKGLMG  360
LNNSVGLGNG AMSLAHGLYF TGESWTNGGS VHDQVSHGNS PQPTVAHHSP FSSLLSLSPG  420
PQLVFYSPEG GGFAVKEASD QFPVDNLEHW QGQLSLNSAR SFLHSGSQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-1960114155Putative transcription factor PCF6
5zkt_B1e-1960114155Putative transcription factor PCF6
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961521.11e-118transcription factor TCP13 isoform X1
RefseqXP_004961522.11e-118transcription factor TCP13 isoform X1
RefseqXP_012700333.11e-118transcription factor TCP13 isoform X1
TrEMBLA0A3L6SYL41e-119A0A3L6SYL4_PANMI; Transcription factor TCP13-like isoform X1
STRINGSi022830m1e-118(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584