PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01005.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 187aa    MW: 20825.6 Da    PI: 9.5504
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01005.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.86.9e-4351381128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk......kvkaeekewyfFskrdkkyatgkr 73 
                                     lppG+rF Pt+eel+++yL++k++g ++++e+vi+ +++y+v+P +L +        +++ + w+fF++r++++a+g r
  Zmw_sc01005.1.g00070.1.sm.mkhc   5 LPPGYRFYPTEEELICFYLRNKLDGLRNDIERVIPVFEVYSVDPGQLTEiharlwGGAGQGEPWFFFCPRQEREARGGR 83 
                                     79****************************99***************8445555422337789**************** PP

                             NAM  74 knratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     ++r+t +gyWka g+  +v++++++++g+kkt+vfy+grap+g++t+W m+eyr+
  Zmw_sc01005.1.g00070.1.sm.mkhc  84 PSRTTPTGYWKAAGTPGAVYAADRRAIGMKKTMVFYRGRAPSGTRTEWKMNEYRA 138
                                     *****************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-463143IPR003441NAC domain
PROSITE profilePS5100541.765181IPR003441NAC domain
PfamPF023657.2E-256137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MASGLPPGYR FYPTEEELIC FYLRNKLDGL RNDIERVIPV FEVYSVDPGQ LTEIHARLWG  60
GAGQGEPWFF FCPRQEREAR GGRPSRTTPT GYWKAAGTPG AVYAADRRAI GMKKTMVFYR  120
GRAPSGTRTE WKMNEYRALQ YDAVGTTDGS SSGAHAAAAP QNLPPQILPP GEHSFQRLRI  180
NVTSISL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-28514017144NO APICAL MERISTEM PROTEIN
1ut4_B3e-28514017144NO APICAL MERISTEM PROTEIN
1ut7_A3e-28514017144NO APICAL MERISTEM PROTEIN
1ut7_B3e-28514017144NO APICAL MERISTEM PROTEIN
4dul_A3e-28514017144NAC domain-containing protein 19
4dul_B3e-28514017144NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970673.11e-87NAC domain-containing protein 90
SwissprotQ9FMR31e-53NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A1E5URX23e-91A0A1E5URX2_9POAL; NAC domain-containing protein 90
STRINGSi002586m4e-87(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]